Property Summary

NCBI Gene PubMed Count 67
PubMed Score 95.45
PubTator Score 82.80

Knowledge Summary

Patent (2,537)

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -5.000 2.4e-07
osteosarcoma 2.668 1.7e-02
Atopic dermatitis -1.500 1.6e-04
lung cancer -1.400 1.0e-03
interstitial cystitis 1.300 1.0e-02
cystic fibrosis and chronic rhinosinusit... -1.592 4.8e-02
invasive ductal carcinoma -1.900 3.2e-03
chronic rhinosinusitis -1.405 2.4e-02
head and neck cancer -1.800 3.1e-02

 GWAS Trait (1)

Gene RIF (50)

PMID Text
26170067 these results indicated that the actions of AKR1C3 can produce FP receptor ligands whose activation results in carcinoma cell survival in breast cancer.
25977569 The results indicated that the rs12731181 G allele of the Prostaglandin F2alpha Receptor Gene was associated with susceptibility to essential hypertension.
25704319 The SNPs of the PTGFR and MMP-1 genes may determine the latanoprost response in a white European Spanish population.
25512374 Angiotensin II type I and prostaglandin F2alpha receptors cooperatively modulate signaling in vascular smooth muscle cells
25339146 Influence of PTGS1, PTGFR, and MRP4 genetic variants on intraocular pressure response to latanoprost in Chinese primary open-angle glaucoma patients
24457363 An association was found between SNPs of the FP receptor gene and the response to latanoprost in patients with glaucoma or OH.
23356224 The F-prostaglandin receptor is a novel marker for tumor endothelial cells in renal cell carcinoma.
22919060 we provide evidence that PGF2alpha induces COX-2 expression via the FP receptor and phosphorylates CREB1 by PKC, thus increasing CREB1 binding to the COX-2 promoter and the expression of COX-2 in human amnion fibroblasts.
22182935 The results of this study suggested that significant novel association signals near the genes PTGFR, and provide supportive evidence for the previously reported association signals near ANK3 and within the 3p21.1 locus.
22060278 we found no indication for an association between SNPs in the prostaglandin F(2alpha) receptor gene or SLCO2A1 and IOP response to prostaglandin analogs in a population of European descent.
20816914 These data demonstrate a role for the FP receptor in regulation of the chemokine CCL20, which can mediate proliferation of endometrial adenocarcinoma epithelial cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20536573 Dental pulp cells expressed prostaglandin FP receptors as analysed by RT-PCR, which showed the presence of 396-bp PCR product. Pulp cells also expressed FP receptor protein (64 kD) as analysed by Western blotting.
20519365 Data show a labour-associated decrease in PTGFR-v1 and PTGFR transcript variant 2 mRNA expression in lower segment myometrial samples.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20140262 Observational study of gene-disease association. (HuGE Navigator)
20092633 The prostaglandin F(2alpha) can directly regulate endothelial cell network formation but not endothelial cell proliferation.
20008143 This study investigated the expression of IL-11 and role of prostaglandin F(2alpha)-F-prostanoid receptor (FP receptor) signaling in the modulation of IL-11 expression in endometrial adenocarcinoma cells.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19819266 our data have elucidated the molecular and cellular mechanism whereby PGF(2alpha) regulates CXCL8 expression via the FP receptor in endometrial adenocarcinomas and have highlighted RCAN1-4 as a negative regulator of CXCL8 expression
19782748 demonstrates that co-activation of the FP and EP2 receptors results in enhanced release of cAMP via FP receptor-G alpha(q)-Ca(2+)-calmodulin pathway by activating calcium sensitive adenylyl cyclase 3 isoform.
19527514 Observational study of gene-disease association. (HuGE Navigator)
19347709 Oxytocin, its receptor and the PGF(2alpha) receptor are involved in the regulation of labour through a paracrine mechanism.
19336370 Observational study of gene-disease association. (HuGE Navigator)
19289115 Expression and functional evidence of the PTGFR mediating contraction in human umbilical vein are reported.
19280705 urinary 8-iso-prostaglandin excretion is enhanced in microalbuminuric compared to nonmicroalbuminuric hypertensive patients or controls
19019335 Observational study of gene-disease association. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18703533 FPR signalling mechanism(s) regulating MLC-2 phosphorylation likely extend beyond those classically established for G(q/11)-coupled receptors
18587449 Bimatoprost lacks effects on the FP receptor but may interact with the FP-altFP receptor heterodimer to induce alterations in second messenger signalling.
18316157 Data show that prostag;andins E2 and F2alpha can mobilize inositol 1,4,5-trisphosphate, induce ERK1/2 phosphorylation and induce cyclooxygenase-2 expression via the FP receptor.
17582204 Observational study of genotype prevalence. (HuGE Navigator)
17582204 A novel PGF2alpha receptor single nucleotide polymorphism (SNP), IVS -97A>T, is common in the Malaysian patients with glaucoma.
17496729 Observational study of gene-disease association. (HuGE Navigator)
17478553 role for PGF(2alpha)-FP receptor interaction in modulating FGF2 expression and signaling using an endometrial adenocarcinoma cell line
17467803 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17467803 rs3753380 and rs3766355, SNPs in the promoter and intron 1 regions of the FP receptor gene, correlate with a response to short-term latanoprost treatment in normal volunteers.
16911823 level at term may facilitate the decidua contribution to parturition, and its regulation and role should be examined further.
16855208 NFkappaB is involved in both basal and interleukin 1beta-stimulated transcription of the PTGFR gene.
16378246 FP receptor activation of Rho signaling by PGF(2alpha) can interfere with nuclear division
16096282 The rabbit prostaglandin F receptor (FP) couples to the inhibitory G protein, Gi, to inhibit vasopressin action in the cortical collecting duct.
16061484 uteroglobin plays important roles in maintaining homeostasis in organs that are vulnerable to inadvertent stimulation of FP-mediated inflammatory response by inhibiting the prostaglandin F2alpha receptor
15748887 The regulation of the FP receptor and the stimulation of production of PGF2alpha in melanocytes in response to ultraviolet radiation suggest that PGF2alpha could act as an autocrine factor for melanocyte differentiation.
15651980 Alterations in the amino acid sequence of the C-terminal domain of PTGFR and their effects on GTP-binding protein signalling are reported.
15118249 prostaglandin F2alpha production is stimulated by withdrawal of ovarian steroids through nuclear factor-kappaB activation via oxygen radicals
14764825 PGF(2 alpha)-FP receptor may promote endometrial tumorigenesis via phospholipase C-mediated phosphorylation of EGF receptor and MAPK signaling pathways.
14746914 isolation and sequencing of 4106-bp promoter DNA fragment that contains -2436-bp of 5'-flanking sequence; identification of transcription initiation start site
12519077 identification of amino acids contributing to ligand speificity or signal transduction properties of this protein
9235889 Functional analysis of the mouse counterpart.

AA Sequence

MSMNNSKQLVSPAAALLSNTTCQTENRLSVFFSVIFMTVGILSNSLAIAILMKAYQRFRQKSKASFLLLA      1 - 70
SGLVITDFFGHLINGAIAVFVYASDKEWIRFDQSNVLCSIFGICMVFSGLCPLLLGSVMAIERCIGVTKP     71 - 140
IFHSTKITSKHVKMMLSGVCLFAVFIALLPILGHRDYKIQASRTWCFYNTEDIKDWEDRFYLLLFSFLGL    141 - 210
LALGVSLLCNAITGITLLRVKFKSQQHRQGRSHHLEMVIQLLAIMCVSCICWSPFLVTMANIGINGNHSL    211 - 280
ETCETTLFALRMATWNQILDPWVYILLRKAVLKNLYKLASQCCGVHVISLHIWELSSIKNSLKVAAISES    281 - 350
PVAEKSAST                                                                 351 - 359
//

Text Mined References (68)

PMID Year Title
26170067 2015 11?-Prostaglandin F2?, a bioactive metabolite catalyzed by AKR1C3, stimulates prostaglandin F receptor and induces slug expression in breast cancer.
25977569 2015 Rare SNP rs12731181 in the miR-590-3p Target Site of the Prostaglandin F2? Receptor Gene Confers Risk for Essential Hypertension in the Han Chinese Population.
25704319 2015 Association between SNPs of Metalloproteinases and Prostaglandin F2? Receptor Genes and Latanoprost Response in Open-Angle Glaucoma.
25512374 2015 Angiotensin II type I and prostaglandin F2? receptors cooperatively modulate signaling in vascular smooth muscle cells.
25339146 2015 Influence of PTGS1, PTGFR, and MRP4 genetic variants on intraocular pressure response to latanoprost in Chinese primary open-angle glaucoma patients.
24457363 2014 Association between genetic polymorphisms of the prostaglandin F2? receptor gene, and response to latanoprost in patients with glaucoma and ocular hypertension.
24376456 2013 Gene-alcohol interactions identify several novel blood pressure loci including a promising locus near SLC16A9.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23356224 2013 The F-prostaglandin receptor is a novel marker for tumor endothelial cells in renal cell carcinoma.
22919060 2012 Cross talk between PKC and CREB in the induction of COX-2 by PGF2? in human amnion fibroblasts.
22182935 2013 Genome-wide association study meta-analysis of European and Asian-ancestry samples identifies three novel loci associated with bipolar disorder.
22060278 2012 Lack of association between polymorphisms in the prostaglandin F2? receptor and solute carrier organic anion transporter family 2A1 genes and intraocular pressure response to prostaglandin analogs.
20816914 2011 Chemokine (C-C) motif ligand 20 is regulated by PGF(2?)-F-prostanoid receptor signalling in endometrial adenocarcinoma and promotes cell proliferation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20536573 2010 Prostaglandin F(2alpha) stimulates MEK-ERK signalling but decreases the expression of alkaline phosphatase in dental pulp cells.
20519365 2010 Labour is associated with decreased expression of the PGF2alpha receptor (PTGFR) and a novel PTGFR splice variant in human myometrium but not decidua.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
20092633 2010 F-Prostaglandin receptor regulates endothelial cell function via fibroblast growth factor-2.
20008143 2010 Interleukin-11 in endometrial adenocarcinoma is regulated by prostaglandin F2alpha-F-prostanoid receptor interaction via the calcium-calcineurin-nuclear factor of activated T cells pathway and negatively regulated by the regulator of calcineurin-1.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19819266 2009 Prostaglandin F(2alpha)-F-prostanoid receptor regulates CXCL8 expression in endometrial adenocarcinoma cells via the calcium-calcineurin-NFAT pathway.
19782748 2010 EP2 receptor mediated cAMP release is augmented by PGF 2 alpha activation of the FP receptor via the calcium-calmodulin pathway.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19347709 2009 Myometrial oxytocin receptor mRNA concentrations at preterm and term delivery - the influence of external oxytocin.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19289115 2009 Expression and functional evidence of the prostaglandin F2alpha receptor mediating contraction in human umbilical vein.
19280705 2009 Determinants of platelet activation in hypertensives with microalbuminuria.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18703533 2008 Prostanoid F receptors elicit an inotropic effect in rat left ventricle by enhancing myosin light chain phosphorylation.
18587449 2008 Identification and pharmacological characterization of the prostaglandin FP receptor and FP receptor variant complexes.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18508192 2008 AKR1C2 and AKR1C3 mediated prostaglandin D2 metabolism augments the PI3K/Akt proliferative signaling pathway in human prostate cancer cells.
18316157 2008 Prostaglandin E2 and F2alpha activate the FP receptor and up-regulate cyclooxygenase-2 expression via the cyclic AMP response element.
17582204 2007 A novel single nucleotide polymorphism, IVS2 -97A>T, in the prostaglandin F2alpha receptor gene was identified among the Malaysian patients with glaucoma.
17496729 2007 Association between polymorphisms in prostanoid receptor genes and aspirin-intolerant asthma.
17478553 2007 F-prostanoid receptor regulation of fibroblast growth factor 2 signaling in endometrial adenocarcinoma cells.
17467803 2007 Association between genetic polymorphisms of the prostaglandin F2alpha receptor gene and response to latanoprost.
16911823 Decidual activation: abundance and localization of prostaglandin F2alpha receptor (FP) mRNA and protein and uterine activation proteins in human decidua at preterm birth and term birth.
16855208 2006 The interleukin 1beta-induced expression of human prostaglandin F2alpha receptor messenger RNA in human myometrial-derived ULTR cells requires the transcription factor, NFkappaB.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16378246 2006 Activation of the human FP prostanoid receptor disrupts mitosis progression and generates aneuploidy and polyploidy.
16096282 2005 Characterization of a rabbit kidney prostaglandin F(2{alpha}) receptor exhibiting G(i)-restricted signaling that inhibits water absorption in the collecting duct.
16061484 2005 Uteroglobin inhibits prostaglandin F2alpha receptor-mediated expression of genes critical for the production of pro-inflammatory lipid mediators.
15748887 2005 Effects of PGF2alpha on human melanocytes and regulation of the FP receptor by ultraviolet radiation.
15651980 2005 Role of the ERC motif in the proximal part of the second intracellular loop and the C-terminal domain of the human prostaglandin F2alpha receptor (hFP-R) in G-protein coupling control.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15118249 2004 Withdrawal of ovarian steroids stimulates prostaglandin F2alpha production through nuclear factor-kappaB activation via oxygen radicals in human endometrial stromal cells: potential relevance to menstruation.
15028279 2004 PCR isolation and cloning of novel splice variant mRNAs from known drug target genes.
14984197 2004 Cloning and localization of hFP(S): a six-transmembrane mRNA splice variant of the human FP prostanoid receptor.
14764825 2004 Expression, localization, and signaling of prostaglandin F2 alpha receptor in human endometrial adenocarcinoma: regulation of proliferation by activation of the epidermal growth factor receptor and mitogen-activated protein kinase signaling pathways.
14746914 2004 Cloning and characterization of the promoter region of the human prostaglandin F2alpha receptor gene.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12519077 2003 Identification by site-directed mutagenesis of amino acids contributing to ligand-binding specificity or signal transduction properties of the human FP prostanoid receptor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11951086 2002 Optimization of RNA isolation from human ocular tissues and analysis of prostanoid receptor mRNA expression using RT-PCR.
10575000 1999 Placenta growth factor and vascular endothelial growth factor B and C expression in microvascular endothelial cells and pericytes. Implication in autocrine and paracrine regulation of angiogenesis.
9918852 1999 Genomic structure, 5' flanking sequences, and precise localization in 1P31.1 of the human prostaglandin F receptor gene.
9341156 1997 Functional characterization of the ocular prostaglandin f2alpha (PGF2alpha) receptor. Activation by the isoprostane, 12-iso-PGF2alpha.
9235889 1997 Failure of parturition in mice lacking the prostaglandin F receptor.
8300593 1994 Cloning and expression of a cDNA for the human prostanoid FP receptor.
8253813 1993 Cloning and expression of a cDNA for the human prostaglandin E receptor EP1 subtype.
8163486 1994 Cloning, functional expression, and characterization of the human prostaglandin E2 receptor EP2 subtype.
7988697 1994 Cloning of the rat and human prostaglandin F2 alpha receptors and the expression of the rat prostaglandin F2 alpha receptor.
7759114 1995 Chromosomal localization of the human prostanoid receptor gene family.