Property Summary

Ligand Count 51
NCBI Gene PubMed Count 69
PubMed Score 99.09
PubTator Score 82.80

Knowledge Summary

Patent (2,537)

Expression

  Differential Expression (9)

Disease log2 FC p
Atopic dermatitis -1.100 1.9e-03
chronic rhinosinusitis -1.405 2.4e-02
cystic fibrosis 1.100 1.6e-02
head and neck cancer -1.800 3.1e-02
interstitial cystitis 1.300 1.0e-02
invasive ductal carcinoma -1.900 3.2e-03
lung cancer -1.400 1.0e-03
malignant mesothelioma -5.000 2.4e-07
osteosarcoma 2.430 4.8e-02

Protein-protein Interaction (8)

Gene RIF (52)

AA Sequence

MSMNNSKQLVSPAAALLSNTTCQTENRLSVFFSVIFMTVGILSNSLAIAILMKAYQRFRQKSKASFLLLA      1 - 70
SGLVITDFFGHLINGAIAVFVYASDKEWIRFDQSNVLCSIFGICMVFSGLCPLLLGSVMAIERCIGVTKP     71 - 140
IFHSTKITSKHVKMMLSGVCLFAVFIALLPILGHRDYKIQASRTWCFYNTEDIKDWEDRFYLLLFSFLGL    141 - 210
LALGVSLLCNAITGITLLRVKFKSQQHRQGRSHHLEMVIQLLAIMCVSCICWSPFLVTMANIGINGNHSL    211 - 280
ETCETTLFALRMATWNQILDPWVYILLRKAVLKNLYKLASQCCGVHVISLHIWELSSIKNSLKVAAISES    281 - 350
PVAEKSAST                                                                 351 - 359
//

Text Mined References (70)

PMID Year Title