Tclin Prostaglandin E2 receptor EP4 subtype

Add to cart

View Collections

Empty Collection

Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. Has a relaxing effect on smooth muscle. May play an important role in regulating renal hemodynamics, intestinal epithelial transport, adrenal aldosterone secretion, and uterine function.

The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor can activate T-cell factor signaling. It has been shown to mediate PGE2 induced expression of early growth response 1 (EGR1), regulate the level and stability of cyclooxygenase-2 mRNA, and lead to the phosphorylation of glycogen synthase kinase-3. Knockout studies in mice suggest that this receptor may be involved in the neonatal adaptation of circulatory system, osteoporosis, as well as initiation of skin immune responses. [provided by RefSeq, Jul 2008]

Comments

Property Summary

Ligand Count	323
NCBI Gene PubMed Count	157
PubMed Score	970.67

PubTator Score	393.04

Knowledge Summary

Patent (38,513)

TINX Plot

Disease (7)

Disease	Target Count	Z-score	Confidence
Endometriosis	540	3.428	1.7
Arthritis, Experimental	39	0.0	0.0
Chloracne	32	0.0	0.0
Inflammation	120	0.0	0.0
Lymphoma	81	0.0	0.0
Ovarian Cysts	41	0.0	0.0
Sexual Dysfunction, Physiological	4	0.0	0.0
Spondylitis, Ankylosing	11	0.0	0.0

Disease	Target Count
Physiological Sexual Disorders	4

Disease	Target Count
Cervical ripening procedure	5
Hydatidiform mole, benign	5
Incomplete miscarriage	6
Induction of labor	6
Pregnancy with abortive outcome	8

Disease	Target Count	P-value
lung carcinoma	2843	6.2e-38
breast carcinoma	1638	9.6e-18
non-small cell lung cancer	2890	3.5e-15
ovarian cancer	8520	3.1e-08
juvenile dermatomyositis	1187	4.1e-07
adrenocortical carcinoma	1428	3.8e-06
Duchenne muscular dystrophy	601	6.3e-06
pancreatic cancer	2398	1.2e-04
osteosarcoma	7950	1.2e-04
Breast cancer	3578	1.3e-04
primary Sjogren syndrome	735	3.9e-04
lung adenocarcinoma	2716	6.1e-04
Astrocytoma, Pilocytic	3081	6.5e-04
intraductal papillary-mucinous adenoma (IPMA)	2955	6.6e-04
lung cancer	4740	7.2e-04
primary pancreatic ductal adenocarcinoma	1109	8.7e-04
autosomal dominant Emery-Dreifuss muscular dystrophy	510	9.5e-04
posterior fossa group A ependymoma	468	9.5e-04
intraductal papillary-mucinous neoplasm (IPMN)	3291	1.7e-03
dermatomyositis	966	2.6e-03
intraductal papillary-mucinous carcinoma (IPMC)	2989	2.7e-03
adrenocortical adenoma	131	5.2e-03
cystic fibrosis	1696	5.9e-03
aldosterone-producing adenoma	665	9.4e-03
glioblastoma	5792	1.2e-02
invasive ductal carcinoma	2951	1.8e-02
esophageal adenocarcinoma	737	2.0e-02
acute myeloid leukemia	783	2.2e-02
colon cancer	1478	2.3e-02
Gaucher disease type 3	67	2.5e-02
group 3 medulloblastoma	4104	4.0e-02
Bipolar Disorder	666	4.6e-02

Disease	Target Count	Z-score	Confidence
Carcinoma	11493	0.0	0.6

Disease	Target Count	Z-score	Confidence
Inflammatory bowel disease	151	3.257	1.6
Ankylosing spondylitis	140	0.0	2.2
Brain cancer	30	0.0	1.0
Crohn's disease	321	0.0	1.7
Malignant glioma	26	0.0	1.0
Multiple Sclerosis	540	0.0	2.5
ulcerative colitis	1819	0.0	3.0

Disease	Target Count	Z-score	Confidence
Cancer	2499	4.892	2.4
Patent ductus arteriosus	90	3.463	1.7
Adenomatoid tumor	7	3.399	1.7
Arthritis	290	3.2	1.6
Vascular disease	319	3.134	1.6

Differential Expression (32)

Disease	log2 FC	p
acute myeloid leukemia	1.500	2.2e-02
adrenocortical adenoma	-1.535	5.2e-03
adrenocortical carcinoma	-2.727	3.8e-06
aldosterone-producing adenoma	-1.778	9.4e-03
Astrocytoma, Pilocytic	1.700	6.5e-04
autosomal dominant Emery-Dreifuss muscul...	1.491	9.5e-04
Bipolar Disorder	1.509	4.6e-02
Breast cancer	-1.400	1.3e-04
breast carcinoma	-1.200	9.6e-18
colon cancer	-2.100	2.3e-02
cystic fibrosis	1.500	5.9e-03
dermatomyositis	1.500	2.6e-03
Duchenne muscular dystrophy	1.147	6.3e-06
esophageal adenocarcinoma	1.900	2.0e-02
Gaucher disease type 3	-1.400	2.5e-02
glioblastoma	1.700	1.2e-02
group 3 medulloblastoma	1.400	4.0e-02
intraductal papillary-mucinous adenoma (...	-2.000	6.6e-04
intraductal papillary-mucinous carcinoma...	-1.500	2.7e-03
intraductal papillary-mucinous neoplasm ...	-2.400	1.7e-03
invasive ductal carcinoma	-1.182	1.8e-02
juvenile dermatomyositis	1.314	4.1e-07
lung adenocarcinoma	-1.700	6.1e-04
lung cancer	-2.500	7.2e-04
lung carcinoma	-2.600	6.2e-38
non-small cell lung cancer	-1.415	3.5e-15
osteosarcoma	1.474	1.2e-04
ovarian cancer	-3.900	3.1e-08
pancreatic cancer	-1.100	1.2e-04
posterior fossa group A ependymoma	1.500	9.5e-04
primary pancreatic ductal adenocarcinoma	-2.264	8.7e-04
primary Sjogren syndrome	1.800	3.9e-04

Lung 18,057

Whole Blood 17,439

Adipose - Subcutaneous 18,110

Adipose - Visceral (Omentum) 17,937

Colon - Transverse 17,825

Breast - Mammary Tissue 18,103

Spleen 17,614

Small Intestine - Terminal Ileum 17,954

Artery - Tibial 17,631

Nerve - Tibial 18,007

Colon - Sigmoid 18,089

Artery - Coronary 17,949

Uterus 17,618

Stomach 17,879

Esophagus - Gastroesophageal Junction 18,000

Thyroid 18,024

Kidney - Cortex 17,329

Esophagus - Muscularis 18,017

Vagina 17,834

Skin - Not Sun Exposed (Suprapubic) 18,081

Pancreas 18,123

Artery - Aorta 17,896

Skin - Sun Exposed (Lower leg) 17,968

Brain - Spinal cord (cervical c-1) 17,973

Testis 18,518

Adrenal Gland 18,071

Cells - Transformed fibroblasts 17,577

Minor Salivary Gland 18,005

Esophagus - Mucosa 18,076

Heart - Left Ventricle 18,006

Prostate 18,213

Heart - Atrial Appendage 17,896

Muscle - Skeletal 17,778

Pituitary 18,147

Brain - Hypothalamus 18,169

Brain - Substantia nigra 17,981

Brain - Amygdala 18,006

Ovary 17,971

Liver 18,071

Cells - EBV-transformed lymphocytes 18,186

Brain - Hippocampus 18,011

Brain - Nucleus accumbens (basal ganglia... 18,024

Brain - Anterior cingulate cortex (BA24) 17,989

Brain - Caudate (basal ganglia) 18,001

Brain - Putamen (basal ganglia) 17,863

Brain - Frontal Cortex (BA9) 18,069

Brain - Cortex 18,039

Brain - Cerebellum 17,983

Brain - Cerebellar Hemisphere 18,015

CD8 Cells 9,840

Adult Frontal Cortex 9,048

Heart

Ovary

Testis

BTO:0004410

adipose tissue 15,837

adrenal gland 15,963

appendix 16,247

bone marrow 14,571

breast 16,063

cerebral cortex 16,630

cervix, uterine 15,871

colon 15,959

duodenum 15,975

endometrium 16,349

epididymis 15,863

esophagus 15,898

fallopian tube 16,245

gallbladder 16,333

heart muscle 14,972

kidney 15,917

liver 14,587

lung 16,312

lymph node 15,833

ovary 15,408

pancreas 14,070

parathyroid gland 14,769

placenta 15,937

prostate 16,460

rectum 15,705

salivary gland 14,981

seminal vesicle 15,918

skeletal muscle 14,011

skin 16,206

small intestine 16,154

smooth muscle 15,857

spleen 15,972

stomach 16,099

testis 17,936

thyroid gland 15,959

tonsil 15,400

urinary bladder 15,814

Liver and Pancreas 16,750

Digestive Tract 17,369

Urinary Tract 16,678

Endocrine System 18,159

Blood and immune system 16,909

Respiratory system 16,393

Female tissues 17,400

Male tissues 17,142

Skin and soft tissues 17,230

Nervous System 16,725

Cardiovascular System 15,192

Brain 7,346

Lung 2,286

See source...

Immune system 1,205

Blood 1,962

Lung 663

ae3 58

Intestine 665

Muscle 1,170

Kidney 888

Ovary 353

Skin 763

Stromal cell 195

Osteoblast 180

Artery 356

Nerve 290

Bone marrow 513

See source...

Synonym

Accession	P35408 Q3MJ87 PGE receptor EP4 subtype
Symbols	EP4 EP4R

Gene

PTGER4

PANTHER Protein Class (2)

receptor 400

G-protein coupled receptor 221

Ortholog (12)

Species	Source	Disease
Cow 15,316	Inparanoid OMA EggNOG
Horse 14,249	Inparanoid OMA EggNOG
Opossum 12,223	Inparanoid OMA EggNOG
Pig 10,164	OMA EggNOG
Xenopus 10,463	Inparanoid OMA EggNOG
Chicken 7,823	Inparanoid OMA EggNOG
Zebrafish 9,725	Inparanoid OMA EggNOG
Chimp 14,136	Inparanoid OMA EggNOG
Mouse 16,567	Inparanoid OMA EggNOG
Macaque 12,758	Inparanoid OMA EggNOG
Dog 15,069	Inparanoid OMA EggNOG
Rat 15,112	Inparanoid OMA EggNOG

UniProt Keyword (12)

Complete proteome 20,231

Reference proteome 20,231

Phosphoprotein 8,216

Cell membrane 3,390

Disulfide bond 3,599

G-protein coupled receptor 830

Glycoprotein 4,623

Membrane 7,361

Receptor 1,502

Transducer 887

See all...

GO Function (1)

prostaglandin E receptor activity 6

GO Component (3)

plasma membrane 4,414

integral component of membrane 3,665

intracellular 566

GO Process (19)

G-protein coupled receptor signaling pat... 1,053

response to lipopolysaccharide 160

immune response 426

response to mechanical stimulus 58

adenylate cyclase-modulating G-protein c... 43

cellular response to mechanical stimulus 78

JNK cascade 50

bone development 43

regulation of stress fiber assembly 15

regulation of ossification 11

See all...

Compartment GO Term (29)

Cell 16,178

Cell part 16,177

Cell periphery 5,382

Cytoskeletal part 1,637

Cytoskeleton 2,108

Integral component of membrane 5,331

Intermediate filament 293

Intermediate filament cytoskeleton 330

Intracellular 14,108

Intracellular non-membrane-bounded organ... 3,975

Intracellular organelle 12,025

Intracellular organelle part 8,784

Intracellular part 13,972

Intrinsic component of membrane 5,458

Macromolecular complex 5,475

See all...

MGI Phenotype (14)

integument phenotype 1,874

homeostasis-metabolism phenotype 4,747

cellular phenotype 3,637

hematopoietic system phenotype 3,383

cardiovascular system phenotype 2,660

mortality-aging 5,018

liver-biliary system phenotype 1,300

respiratory system phenotype 1,390

skeleton phenotype 2,222

immune system phenotype 3,461

See all...

GWAS Trait (1)

Gastric cancer 9

HCA RNA Cell Line (54)

A-431 16,131

A549 15,174

AN3-CA 15,648

ASC TERT1 14,842

BEWO 16,726

BJ 15,448

BJ hTERT+ 15,353

BJ hTERT+ SV40 Large T+ 15,609

BJ hTERT+ SV40 Large T+ RasG12V 15,493

CACO-2 15,436

See all...

Pathway (17)

Neuroactive ligand-receptor interaction 276

Human papillomavirus infection 388

Pathways in cancer 530

Inflammatory mediator regulation of TRP ... 99

Renin secretion 68

Signal Transduction 2,657

Class A/1 (Rhodopsin-like receptors) 322

GPCR downstream signalling 1,157

GPCR ligand binding 459

Signaling by GPCR 1,217

See all...

Drug (4)

dinoprostone
pKi 9.77

beraprost
pKi 5.14

treprostinil
pKi 6.10

iloprost
pEC50 6.40

Ligand (318)

CHEMBL3260761
pKi 7.00

CHEMBL3793912
pIC50 7.02

CHEMBL3260437
pKi 7.05

CHEMBL3792999
pIC50 7.06

CHEMBL3260760
pKi 7.07

CHEMBL3793994
pIC50 7.08

CHEMBL1669024
pIC50 7.10

CHEMBL192303
pKi 7.10

CHEMBL3260430
pKi 7.10

CHEMBL3260431
pKi 7.10

CHEMBL1669008
pIC50 7.11

CHEMBL3600788
pIC50 7.11

CHEMBL1645146
pKi 7.12

CHEMBL3686863
pKi 7.12

CHEMBL1644012
pKi 7.13

CHEMBL3753221
pEC50 7.14

CHEMBL3753133
pIC50 7.14

CHEMBL3600884
pIC50 7.14

CHEMBL3115074
pIC50 7.16

CHEMBL1644015
pKi 7.17

See all 318 ligands...

Gene RIF (126)

AA Sequence

MSTPGVNSSASLSPDRLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCGLAVTDLLGTL      1 - 70
LVSPVTIATYMKGQWPGGQPLCEYSTFILLFFSLSGLSIICAMSVERYLAINHAYFYSHYVDKRLAGLTL     71 - 140
FAVYASNVLFCALPNMGLGSSRLQYPDTWCFIDWTTNVTAHAAYSYMYAGFSSFLILATVLCNVLVCGAL    141 - 210
LRMHRQFMRRTSLGTEQHHAAAAASVASRGHPAASPALPRLSDFRRRRSFRRIAGAEIQMVILLIATSLV    211 - 280
VLICSIPLVVRVFVNQLYQPSLEREVSKNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCR    281 - 350
IGGSRRERSGQHCSDSQRTSSAMSGHSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPG    351 - 420
MGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEAGGSGRAGPAPKGSSLQVTFPSETLNLSEKCI      421 - 488
//

Text Mined References (157)

Summary
Details

	PMID	Year	Title

Tclin Prostaglandin E2 receptor EP4 subtype Add to cart View Collections Empty Collection

Property Summary

Knowledge Summary

Patent (38,513)

TINX Plot

Disease (7)

Expression

Differential Expression (32)

Synonym

Gene

PANTHER Protein Class (2)

Ortholog (12)

UniProt Keyword (12)

GO Function (1)

GO Component (3)

GO Process (19)

Compartment GO Term (29)

MGI Phenotype (14)

GWAS Trait (1)

HCA RNA Cell Line (54)

Pathway (17)

Drug (4)

Ligand (318)

Gene RIF (126)

AA Sequence

Text Mined References (157)

Tclin Prostaglandin E2 receptor EP4 subtype

Add to cart

View Collections

Empty Collection