Property Summary

Ligand Count 323
NCBI Gene PubMed Count 157
PubMed Score 970.67
PubTator Score 393.04

Knowledge Summary

Patent (38,513)

TINX Plot

  Disease (7)

Disease Target Count
Physiological Sexual Disorders 4
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (32)

Disease log2 FC p
acute myeloid leukemia 1.500 2.2e-02
adrenocortical adenoma -1.535 5.2e-03
adrenocortical carcinoma -2.727 3.8e-06
aldosterone-producing adenoma -1.778 9.4e-03
Astrocytoma, Pilocytic 1.700 6.5e-04
autosomal dominant Emery-Dreifuss muscul... 1.491 9.5e-04
Bipolar Disorder 1.509 4.6e-02
Breast cancer -1.400 1.3e-04
breast carcinoma -1.200 9.6e-18
colon cancer -2.100 2.3e-02
cystic fibrosis 1.500 5.9e-03
dermatomyositis 1.500 2.6e-03
Duchenne muscular dystrophy 1.147 6.3e-06
esophageal adenocarcinoma 1.900 2.0e-02
Gaucher disease type 3 -1.400 2.5e-02
glioblastoma 1.700 1.2e-02
group 3 medulloblastoma 1.400 4.0e-02
intraductal papillary-mucinous adenoma (... -2.000 6.6e-04
intraductal papillary-mucinous carcinoma... -1.500 2.7e-03
intraductal papillary-mucinous neoplasm ... -2.400 1.7e-03
invasive ductal carcinoma -1.182 1.8e-02
juvenile dermatomyositis 1.314 4.1e-07
lung adenocarcinoma -1.700 6.1e-04
lung cancer -2.500 7.2e-04
lung carcinoma -2.600 6.2e-38
non-small cell lung cancer -1.415 3.5e-15
osteosarcoma 1.474 1.2e-04
ovarian cancer -3.900 3.1e-08
pancreatic cancer -1.100 1.2e-04
posterior fossa group A ependymoma 1.500 9.5e-04
primary pancreatic ductal adenocarcinoma -2.264 8.7e-04
primary Sjogren syndrome 1.800 3.9e-04

 GWAS Trait (1)

Gene RIF (126)

AA Sequence

MSTPGVNSSASLSPDRLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCGLAVTDLLGTL      1 - 70
LVSPVTIATYMKGQWPGGQPLCEYSTFILLFFSLSGLSIICAMSVERYLAINHAYFYSHYVDKRLAGLTL     71 - 140
FAVYASNVLFCALPNMGLGSSRLQYPDTWCFIDWTTNVTAHAAYSYMYAGFSSFLILATVLCNVLVCGAL    141 - 210
LRMHRQFMRRTSLGTEQHHAAAAASVASRGHPAASPALPRLSDFRRRRSFRRIAGAEIQMVILLIATSLV    211 - 280
VLICSIPLVVRVFVNQLYQPSLEREVSKNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCR    281 - 350
IGGSRRERSGQHCSDSQRTSSAMSGHSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPG    351 - 420
MGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEAGGSGRAGPAPKGSSLQVTFPSETLNLSEKCI      421 - 488
//

Text Mined References (157)

PMID Year Title