Property Summary

Ligand Count 393
NCBI Gene PubMed Count 89
PubMed Score 622.68
PubTator Score 178.56

Knowledge Summary

Patent (25,624)

TINX Plot

  Disease (7)

Disease Target Count
Drug allergy 36
Schizophrenia 1160
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 3.461 1.7
Conjunctivochalasis 6 3.271 1.6
Allergic conjunctivitis 22 3.201 1.6

Expression

  Differential Expression (25)

Disease log2 FC p
adrenocortical adenoma -1.609 2.4e-02
adrenocortical carcinoma -2.037 2.4e-04
adult high grade glioma -1.700 2.0e-02
aldosterone-producing adenoma -1.501 1.4e-02
astrocytic glioma -2.000 1.2e-03
Astrocytoma, Pilocytic -2.300 4.0e-05
Atopic dermatitis -1.200 7.4e-03
atypical teratoid / rhabdoid tumor -2.400 1.5e-05
colon cancer -1.200 1.9e-03
ductal carcinoma in situ -2.000 5.3e-04
ependymoma -1.900 1.1e-02
gastric carcinoma -1.600 8.6e-03
glioblastoma -2.200 4.9e-08
group 3 medulloblastoma -2.000 4.4e-02
intraductal papillary-mucinous adenoma (... -3.100 3.7e-06
intraductal papillary-mucinous carcinoma... -3.100 5.7e-06
intraductal papillary-mucinous neoplasm ... -3.000 4.1e-04
invasive ductal carcinoma -2.200 3.9e-03
medulloblastoma, large-cell -2.300 1.9e-02
oligodendroglioma -2.400 6.9e-04
ovarian cancer -1.600 6.3e-09
periodontitis -1.100 8.7e-20
pituitary cancer 1.800 5.9e-03
primitive neuroectodermal tumor -2.000 3.3e-02
psoriasis 1.300 1.1e-06

 CSPA Cell Line (1)

Gene RIF (70)

AA Sequence

MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLLTGFVGNALAM      1 - 70
LLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRWEHIDPSGRLCTFFGLTMTVF     71 - 140
GLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLGVWLAVLAFALLPVLGVGQYTVQWPGTWCFI    141 - 210
STGRGGNGTSSSHNWGNLFFASAFAFLGLLALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTET    211 - 280
AIQLMGIMCVLSVCWSPLLIMMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLR    281 - 350
KILLRKFCQIRYHTNNYASSSTSLPCQCSSTLMWSDHLER                                  351 - 390
//

Text Mined References (91)

PMID Year Title