Property Summary

Ligand Count 413
NCBI Gene PubMed Count 52
PubMed Score 401.98
PubTator Score 198.10

Knowledge Summary

Patent (33,999)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.485 1.4e-08
ovarian cancer -1.100 1.2e-05
psoriasis 1.200 4.3e-04

Gene RIF (44)

AA Sequence

MSPCGPLNLSLAGEATTCAAPWVPNTSAVPPSGASPALPIFSMTLGAVSNLLALALLAQAAGRLRRRRSA      1 - 70
ATFLLFVASLLATDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMVFFGLCPLLLGCGMAVERCVGVT     71 - 140
RPLLHAARVSVARARLALAAVAAVALAVALLPLARVGRYELQYPGTWCFIGLGPPGGWRQALLAGLFASL    141 - 210
GLVALLAALVCNTLSGLALLRARWRRRSRRPPPASGPDSRRRWGAHGPRSASASSASSIASASTFFGGSR    211 - 280
SSGSARRARAHDVEMVGQLVGIMVVSCICWSPMLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWV    281 - 350
YILLRQAVLRQLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLSHF                      351 - 402
//

Text Mined References (52)

PMID Year Title