Property Summary

NCBI Gene PubMed Count 49
PubMed Score 387.16
PubTator Score 198.10

Knowledge Summary

Patent (33,999)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.600 1.0e-03
osteosarcoma 2.098 9.8e-08
ovarian cancer -1.100 1.2e-05

Gene RIF (41)

PMID Text
25289898 NF-kappaB inhibitor suppressed 17-PT-PGE2-mediated FoxC2 upregulation. Immunohistochemistry showed p65, FoxC2, EP1 receptor and beta1-integrin were all highly expressed in the HCC cases
24614038 A transient interaction between COX-2 and EP1 constitutes a feedback loop whereby an increase in COX-2 expression elevates EP1.
24333447 COX-1, H446K' is significantly more sensitive to downregulation by EP . Together these data suggest that distinctive ubiquitination of COX-1 and COX-2 may be responsible for their different sensitivity to EP -mediated degradation.
23842570 through complex formation with D1, EP1 signaling directs the D1 receptor through G(betagamma) to be coupled to AC7.
23525457 Our study suggests that the PGE EP1 receptor regulates FAK phosphorylation by activating the PKC/c-Src and EGFR signal pathways, which may coordinately regulate adhesion and migration in HCC
23494562 PGE2-enhanced MMP2 expression is mediated through EP1 receptors and calcium signaling pathway-induced CREB phosphorylation in human cholangiocarcinoma cells.
22924768 PGE(2) -mediated NF-kappaB activation by simultaneous stimulation of EP(1) and EP(4) receptors induces maximal IL-8 promoter activation and IL-8 mRNA and protein induction
22555372 Suggest that the anti-carcinogenic effects of EGCG in hepatocellular carcinoma might be mediated, at least partially, through the suppressing EP(1) receptor expression and PGE(2) production.
22474323 new role for the EP(1) receptor in resolving inflammation through down-regulation of COX-2.
22276108 Neuroblastoma express all four forms of PGE(2) receptors.
22162473 The roles of prostaglandin EP 1 and 3 receptors in the control of human myometrial contractility.
22110249 A novel dendritic cell(DC) progenitor regulatory pathway in which PGE(2) signaling through EP1/EP3 receptors regulates Flt3 expression and downstream STAT3 activation and survivin expression, required for optimal progenitor survival and differentiation.
21813027 Data indicate that not only Cox-2 but also EP1 and EP3 could be important targets for chemosensitization and inhibition of metastasis in breast cancers that are resistant to chemotherapy.
21447366 We could not find an association of EP1 gene with suicide in the Japanese population
21052031 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20858737 EP1 functions as a suppressor of tumor metastasis; loss of nuclear EP1 is associated with poorer overall survival and may contribute to disparities in outcome in different populations.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20647315 the PGE(2) and EP1 interaction enhanced migration of oral cancer cells through an increase in ICAM-1 production
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20587336 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20178602 Prostaglandin E2 enhances the migration of chondrosarcoma cells by increasing alpha2beta1 integrin expression through the EP1/PLC/PKCalpha/c-Src/NF-kappaB signal transduction pathway.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19625175 The EP1 subtype of prostaglandin E2 receptor has a role in keratinocyte differentiation and expression in non-melanoma skin cancer.
19336370 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18516068 Of the 4 EP receptor subtypes, smooth muscle cells in the human pulmonary vein express the EP4 and EP1 receptor subtypes
17906615 Expression of EP1 is frequently seen in human breast cancers. Nuclear expression of EP1 correlates with good prognosis markers like node negative status and progesterone receptor expression.
17877755 Observational study of gene-disease association. (HuGE Navigator)
17611676 Results show co-expression of cyclooxygenase-2 and prostaglandin E2 receptors EP1, 2 and 4 in non-small cell lung cancer cells concomitant with the synthesis of PGE2.
17525067 participates in placentation through EVT invasion by up-regulating PGE2 production and PGE2 receptor expression in first trimester extravillous trophoblasts
17496729 Observational study of gene-disease association. (HuGE Navigator)
16670773 EP(1) does not appear to have a significant direct effect on airway tone but acts as a modulator of the beta(2)AR, altering G(alphas) coupling via steric interactions imposed by the EP(1):beta(2)AR heterodimeric signaling complex
16393343 EP1 receptor level increase in sensory neurones, and macrophage infiltration, appears to precede increased Cox-2 expression by macrophages in nerve injury
15886234 PGE2 stimulates extravillous trophoblast migration by signaling through EP1 receptors, increasing [Ca2+]i, and activating calpain
14744769 COX-2 up-regulates VEGF-C and promotes lymphangiogenesis in human lung adenocarcinoma via the EP(1)/Src/HER-2/Neu signaling pathway.
14562138 Human corpus cavernosum and cultured smooth muscle cells express EP1, EP2 and EP3 receptors.
12841871 the combined effects of EP(1) and EP(4) antagonists on spontaneous polyp formation in APC knockout mice
12788892 Agonists of EP(1) and EP(2) significantly increased aromatase activity levels, which were decreased by the corresponding antagonists. Generally reflective of changes in aromatase protein expression and the pattern of mRNA expression.
12642666 Functional analysis of the mouse counterpart.
1160156 Functional analysis of the mouse counterpart.

AA Sequence

MSPCGPLNLSLAGEATTCAAPWVPNTSAVPPSGASPALPIFSMTLGAVSNLLALALLAQAAGRLRRRRSA      1 - 70
ATFLLFVASLLATDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMVFFGLCPLLLGCGMAVERCVGVT     71 - 140
RPLLHAARVSVARARLALAAVAAVALAVALLPLARVGRYELQYPGTWCFIGLGPPGGWRQALLAGLFASL    141 - 210
GLVALLAALVCNTLSGLALLRARWRRRSRRPPPASGPDSRRRWGAHGPRSASASSASSIASASTFFGGSR    211 - 280
SSGSARRARAHDVEMVGQLVGIMVVSCICWSPMLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWV    281 - 350
YILLRQAVLRQLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLSHF                      351 - 402
//

Text Mined References (49)

PMID Year Title
25289898 2014 Prostaglandin E2 stimulates ?1-integrin expression in hepatocellular carcinoma through the EP1 receptor/PKC/NF-?B pathway.
24614038 2014 Upregulation of prostaglandin receptor EP1 expression involves its association with cyclooxygenase-2.
24333447 2014 Prostaglandin receptor EP?-mediated differential degradation of cyclooxygenases involves a specific lysine residue.
23842570 2013 Prostaglandin E receptor EP1 forms a complex with dopamine D1 receptor and directs D1-induced cAMP production to adenylyl cyclase 7 through mobilizing G(??) subunits in human embryonic kidney 293T cells.
23525457 2013 Prostaglandin E? receptor EP1-mediated phosphorylation of focal adhesion kinase enhances cell adhesion and migration in hepatocellular carcinoma cells.
23494562 2013 Prostaglandin E2 receptor EP1 phosphorylate CREB and mediates MMP2 expression in human cholangiocarcinoma cells.
22924768 2013 NF-?B-dependent IL-8 induction by prostaglandin E(2) receptors EP(1) and EP(4).
22555372 2012 Prostanoid EP1 receptor as the target of (-)-epigallocatechin-3-gallate in suppressing hepatocellular carcinoma cells in vitro.
22474323 2012 Prostaglandin EP1 receptor down-regulates expression of cyclooxygenase-2 by facilitating its proteasomal degradation.
22276108 2012 Autocrine prostaglandin E2 signaling promotes tumor cell survival and proliferation in childhood neuroblastoma.
22162473 2012 The roles of prostaglandin EP 1 and 3 receptors in the control of human myometrial contractility.
22110249 2012 Blockade of prostaglandin E2 signaling through EP1 and EP3 receptors attenuates Flt3L-dependent dendritic cell development from hematopoietic progenitor cells.
21813027 2011 Involvement of Cox-2 in the metastatic potential of chemotherapy-resistant breast cancer cells.
21447366 2011 Association study of EP1 gene polymorphisms with suicide completers in the Japanese population.
21052031 2011 Identification of genetic factors associated with susceptibility to angiotensin-converting enzyme inhibitors-induced cough.
20858737 2010 Prostaglandin E receptor EP1 suppresses breast cancer metastasis and is linked to survival differences and cancer disparities.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20647315 2010 Prostaglandin E2/EP1 signaling pathway enhances intercellular adhesion molecule 1 (ICAM-1) expression and cell motility in oral cancer cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20587336 2010 Association of PTGER gene family polymorphisms with aspirin intolerant asthma in Korean asthmatics.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20178602 2010 Cyclooxygenase-2 enhances alpha2beta1 integrin expression and cell migration via EP1 dependent signaling pathway in human chondrosarcoma cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19625175 2009 The EP1 subtype of prostaglandin E2 receptor: role in keratinocyte differentiation and expression in non-melanoma skin cancer.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
18516068 2008 Vasorelaxation induced by prostaglandin E2 in human pulmonary vein: role of the EP4 receptor subtype.
17906615 2008 Prostanoid receptor EP1 expression in breast cancer.
17877755 2007 Association between genetic variations in prostaglandin E2 receptor subtype EP3 gene (Ptger3) and asthma in the Korean population.
17611676 2007 Specific components of prostanoid-signaling pathways are present in non-small cell lung cancer cells.
17525067 2007 Induction of prostaglandin E2 production by leukemia inhibitory factor promotes migration of first trimester extravillous trophoblast cell line, HTR-8/SVneo.
17496729 2007 Association between polymorphisms in prostanoid receptor genes and aspirin-intolerant asthma.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16670773 2006 Airway smooth muscle prostaglandin-EP1 receptors directly modulate beta2-adrenergic receptors within a unique heterodimeric complex.
16393343 2006 Prostanoid receptor EP1 and Cox-2 in injured human nerves and a rat model of nerve injury: a time-course study.
15886234 2005 EP1 receptor-mediated migration of the first trimester human extravillous trophoblast: the role of intracellular calcium and calpain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14744769 2004 Cyclooxygenase-2 induces EP1- and HER-2/Neu-dependent vascular endothelial growth factor-C up-regulation: a novel mechanism of lymphangiogenesis in lung adenocarcinoma.
14562138 2003 Functional prostaglandin E (EP) receptors in human penile corpus cavernosum.
12841871 2003 Combined effects of prostaglandin E receptor subtype EP1 and subtype EP4 antagonists on intestinal tumorigenesis in adenomatous polyposis coli gene knockout mice.
12788892 2003 Prostaglandin E2 regulates aromatase activity and expression in human adipose stromal cells via two distinct receptor subtypes.
12642666 2003 Impaired adrenocorticotropic hormone response to bacterial endotoxin in mice deficient in prostaglandin E receptor EP1 and EP3 subtypes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11951086 2002 Optimization of RNA isolation from human ocular tissues and analysis of prostanoid receptor mRNA expression using RT-PCR.
11235015 2001 Induction of IL-6 via the EP3 subtype of prostaglandin E receptor in rat adjuvant-arthritic synovial cells.
8253813 1993 Cloning and expression of a cDNA for the human prostaglandin E receptor EP1 subtype.
7938166 1994 International Union of Pharmacology classification of prostanoid receptors: properties, distribution, and structure of the receptors and their subtypes.
7759114 1995 Chromosomal localization of the human prostanoid receptor gene family.
1160156 1975 A nonlinear regression model as applied to the comparison of axis-angles of electrocardiographic systems.