Property Summary

NCBI Gene PubMed Count 69
PubMed Score 509.59
PubTator Score 409.72

Knowledge Summary

Patent (58,835)

TINX Plot

  Disease (6)

Disease Target Count
Dyslipidemia 1
Disease Target Count Z-score Confidence
Asthma 349 4.156 2.1
Disease Target Count Z-score Confidence
Allergic rhinitis 92 3.095 1.5
Disease Target Count
Asthma-related traits 1 1

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -2.761 1.6e-06
Crohn's disease -1.078 1.1e-03
active ulcerative colitis -2.093 4.1e-02
tuberculosis 1.800 3.6e-03
colon cancer -2.900 2.1e-02
lung cancer -1.500 2.5e-04
posterior fossa group B ependymoma 1.500 1.1e-03
lung carcinoma -1.500 2.5e-18
ovarian cancer -3.800 5.4e-23

Gene RIF (58)

PMID Text
26792210 PGD2 markedly augments disease activity through its ability to enhance the proinflammatory actions of macrophages and subsequent neutrophil activation.
25681680 EP2 receptors exhibit more constraints to mutations than DP receptors.
25142778 Non-obligatory role of prostaglandin D2 receptor subtype 1 in rosacea: laropiprant in comparison to a placebo did not alleviate the symptoms of erythematoelangiectaic rosacea
24922638 Low DP1 prostanoid receptor is associated with gastric cancer progression.
24493589 Lipocalin-type prostaglandin D2 (PGD2) synthase (L-PGDS) interacts intracellularly with the G protein-coupled receptor DP1 in an agonist-independent manner.
23307871 PGD(2)-DP signaling reduces vascular permeability via endothelial cAMP/PKA/Tiam1/Rac1 pathway.
23192614 the PTGDR -549 C/T polymorphism confers susceptibility to asthma in Europeans and adults. However, no association was found between the PTGDR 441 C/T and -197 C/T polymorphisms or the CCC and TCT haplotypes and asthma susceptibility.
23181793 Genetic variant may play a role in NSAID induced acute urticaria.
22182808 The PTGDR -441C/T polymorphism is not associated with asthma or its phenotypes in the North Indian population.
21930295 DP receptors amplify the biological response to CRTH2 activation and the CRTH2/DP heteromer might represent both a functional signaling unit for PGD(2) and a potential target for development of heteromer-directed therapy for allergic diseases
21883277 Genetic combinations described have functional implications in the PTGDR promoter activity by changing the transcription factors affinity that will help characterize different risk groups.
21832046 PGD(2) can induce MUC5B overproduction via ERK MAPK/RSK1/CREB signaling and that DP1 receptor may have suppressive effects in controlling MUC5B overproduction in the airway.
21624751 DP mediates eosinophils through the elevation of intracellular cAMP production but does not change CRTH2 expression; balance between DP and CRTH2 could influence the degree of PGD2-induced eosinophil migration
21426314 DP(1) receptors coupled to G(alphas) increase adenylate cyclase activity and cAMP/protein kinase A-dependent formation of lipid bodies, and DP(2) receptors coupled to G(alphai) increase calcium; each of these signals is required for LTC(4) production
21307858 Polymorphisms of the PTGDR and LTC4S influence responsiveness to leukotriene receptor antagonists in Korean children with asthma.
21199159 These results suggest that despite the non-significant findings in the present study populations, prostanoid D2 receptor promoter haplotypes may account for a small but significant proportion of the risk of asthma in Caucasian populations.
20973774 during allergen-elicited eosinophilic inflammatory reactions, cysteinyl-leukotriene production is regulated by DP1/DP2-orchestrated eosinophil activation
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20308056 Mast cell-derived prostaglandin D2 controls hyaluronan synthesis in human orbital fibroblasts via DP1 activation: implications for thyroid eye disease.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19748656 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19710676 Prostanoid DP receptor (PTGDR) polymorhisms variants was found in a subset of mothers with post-coital associated preterm births
19710676 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
19264973 Observational study of gene-disease association. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19237393 Observational study of gene-disease association. (HuGE Navigator)
19220773 Our results do not support PTGDR to be a major candidate gene for asthma traits and atopy in Chinese children.
19220773 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18957281 PGD(2) induces HO-1 mRNA expression through DP2 receptor, linking the PGD(2)-DP2 signaling with heme homeostasis.
18811623 promoter polymorphism association in Spanish children with asthma
18811623 Observational study of gene-disease association. (HuGE Navigator)
18802357 These results suggest that expression of DP and CRTH2 is associated with the pathophysiology of chronic rhinosinusitis, and the expression of these receptors may be regulated by h-PGDS and PGD.
18797183 level of exptression in nasal polyps correlates with chronic rhinosinusitis associated with bronchial asthma
18005048 Expression of prostaglandin E(2) receptors (EP(2), EP(3), EP(4)), prostaglandin D(2) receptor (DP(2)), prostanoid thromboxane A(2) receptor (TP) and to a lesser extent EP(1) were observed in several hair follicle compartments.
17965752 activation of DP(1) may contribute to the long lasting blood flow changes in the target organ--REVIEW
17878378 D-type prostanoid (DP) receptors comediate with CRTH2 the mobilization of eosinophils from bone marrow and their chemotaxis, which might provide the rationale for DP antagonists in the treatment of allergic disease
17845306 Observational study of gene-disease association. (HuGE Navigator)
17845306 These results suggest that the three PTGDR gene promoter polymorphisms studied are not important risk factors for asthma susceptibility in the Chinese Han population.
17541272 Review. PGD(2) exerts its effects partly through the D-prostanoid receptor. The distribution of DP expression depends on the type of tissue and environment with/without inflammation.
17538632 Observational study of gene-disease association. (HuGE Navigator)
17538632 study demonstrated significant evidence of association between polymorphisms in PTGDR with asthma phenotypes in two Caucasian populations
17496729 Observational study of gene-disease association. (HuGE Navigator)
17307163 activation of the prostanoid DP receptor on THP-1 cells enhances TNF-alpha-induced MCP-1 and IL-8 production via the cAMP/PKA signaling pathway
17157653 Observational study of gene-disease association. (HuGE Navigator)
16629782 Observational study of gene-disease association. (HuGE Navigator)
15749909 DP2 might play a critical role in allergic diseases
15496624 Observational study of gene-disease association. (HuGE Navigator)
15496624 Our functional and genetic findings identify PTGDR as an asthma-susceptibility gene.
15004188 Activation of the D prostanoid receptor DP1 impedes the TNF-alpha-induced migration of Langerhans cells (LC) from skin explants and strongly inhibits chemotactic responses of LC precursors and maturing LCs to CC chemokine ligands 20 and 19, respectively.
12895603 amino acid sequence alignment of human, mouse and rat DP receptors
12230502 Association of a new-type prostaglandin D2 receptor CRTH2 with circulating T helper 2 cells in patients with atopic dermatitis.
12002745 New polymorphisms of human prostanoid DP receptor gene.

AA Sequence

MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSVFYMLVCGLTV      1 - 70
TDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSSTLQLLAMALECWLSLGHPFFY     71 - 140
RRHITLRLGALVAPVVSAFSLAFCALPFMGFGKFVQYCPGTWCFIQMVHEEGSLSVLGYSVLYSSLMALL    141 - 210
VLATVLCNLGAMRNLYAMHRRLQRHPRSCTRDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLP    211 - 280
VIYRAYYGAFKDVKEKNRTSEEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCS    281 - 350
NSTNMESSL                                                                 351 - 359
//

Text Mined References (72)

PMID Year Title
26792210 2016 Activated prostaglandin D2 receptors on macrophages enhance neutrophil recruitment into the lung.
25681680 2015 Human EP2 prostanoid receptors exhibit more constraints to mutations than human DP prostanoid receptors.
25142778 2015 Non-obligatory role of prostaglandin D2 receptor subtype 1 in rosacea: laropiprant in comparison to a placebo did not alleviate the symptoms of erythematoelangiectaic rosacea.
24922638 2014 The role of type D prostanoid receptors and PPAR? in gastric cancer progression.
24836286 2014 Large-scale genetic study in East Asians identifies six new loci associated with colorectal cancer risk.
24493589 2014 A G protein-coupled receptor and the intracellular synthase of its agonist functionally cooperate.
24045676 2014 Genome-wide association studies and epistasis analyses of candidate genes related to age at menarche and age at natural menopause in a Korean population.
23770605 2013 Genome-wide association study identifies multiple risk loci for chronic lymphocytic leukemia.
23307871 2013 Prostaglandin D2-DP signaling promotes endothelial barrier function via the cAMP/PKA/Tiam1/Rac1 pathway.
23192614 2013 PTGDR polymorphisms and susceptibility to asthma: a meta-analysis.
23181793 2012 Genetic variants of the arachidonic acid pathway in non-steroidal anti-inflammatory drug-induced acute urticaria.
22182808 2011 No association of PTGDR -441C/T polymorphism with asthma in a North Indian population.
21930295 2012 D-type prostanoid receptor enhances the signaling of chemoattractant receptor-homologous molecule expressed on T(H)2 cells.
21883277 2011 PTGDR gene in asthma: a functional, genetic, and epigenetic study.
21832046 2011 The extracellular signal-regulated kinase mitogen-activated protein kinase/ribosomal S6 protein kinase 1 cascade phosphorylates cAMP response element-binding protein to induce MUC5B gene expression via D-prostanoid receptor signaling.
21624751 2011 The opposing role of two prostaglandin D2 receptors, DP and CRTH2, in human eosinophil migration.
21426314 2011 R2D(2) for C(4)Eo: an 'alliance' of PGD(2) receptors is required for LTC(4) production by human eosinophils.
21307858 2011 Polymorphisms of the PTGDR and LTC4S influence responsiveness to leukotriene receptor antagonists in Korean children with asthma.
21199159 2011 Functional haplotypes in the PTGDR gene fail to associate with asthma in two Australian populations.
20973774 2011 Co-operative signalling through DP(1) and DP(2) prostanoid receptors is required to enhance leukotriene C(4) synthesis induced by prostaglandin D(2) in eosinophils.
20959461 2010 ANKRD13C acts as a molecular chaperone for G protein-coupled receptors.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20308056 2010 Mast cell-derived prostaglandin D2 controls hyaluronan synthesis in human orbital fibroblasts via DP1 activation: implications for thyroid eye disease.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19748656 2009 Clinical studies of the DP1 antagonist laropiprant in asthma and allergic rhinitis.
19710676 2010 Prostanoid DP receptor (PTGDR) variants in mothers with post-coital associated preterm births: preliminary observations.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19264973 2009 Assessing the reproducibility of asthma candidate gene associations, using genome-wide data.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19237393 2009 Positionally cloned asthma susceptibility gene polymorphisms and disease risk in the British 1958 Birth Cohort.
19220773 2009 PTGDR is not a major candidate gene for asthma and atopy in Chinese children.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
18957281 2008 Prostaglandin D2 induces heme oxygenase-1 mRNA expression through the DP2 receptor.
18811623 2009 A new PTGDR promoter polymorphism in a population of children with asthma.
18802357 2009 Expression and characterization of PGD2 receptors in chronic rhinosinusitis: modulation of DP and CRTH2 by PGD2.
18797183 2008 Correlation between the prostaglandin D(2)/E(2) ratio in nasal polyps and the recalcitrant pathophysiology of chronic rhinosinusitis associated with bronchial asthma.
18005048 2008 Prostanoid receptors in anagen human hair follicles.
17965752 2008 The roles of the prostaglandin D(2) receptors DP(1) and CRTH2 in promoting allergic responses.
17878378 2007 The role of the prostaglandin D2 receptor, DP, in eosinophil trafficking.
17845306 2007 Lack of association between three promoter polymorphisms of PTGDR gene and asthma in a Chinese Han population.
17541272 2007 Possible novel receptor for PGD2 on human bronchial epithelial cells.
17538632 2007 Association of PTGDR gene polymorphisms with asthma in two Caucasian populations.
17496729 2007 Association between polymorphisms in prostanoid receptor genes and aspirin-intolerant asthma.
17307163 2007 Synergistic effect of PGD2 via prostanoid DP receptor on TNF-alpha-induced production of MCP-1 and IL-8 in human monocytic THP-1 cells.
17157653 2006 The PTGDR gene is not associated with asthma in 3 ethnically diverse populations.
16629782 2006 Promoter genetic variants of prostanoid DP receptor (PTGDR) gene in patients with asthma.
15749909 2005 Activation of the prostaglandin D2 receptor DP2/CRTH2 increases allergic inflammation in mouse.
15496624 2004 Role of prostanoid DP receptor variants in susceptibility to asthma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15028279 2004 PCR isolation and cloning of novel splice variant mRNAs from known drug target genes.
15004188 2004 Activation of the D prostanoid receptor 1 regulates immune and skin allergic responses.
12895603 The role of mast cells in asthma.
12672054 2003 Prostaglandin D2 inhibits the production of interleukin-12 in murine dendritic cells through multiple signaling pathways.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12494276 2002 Expression of functional prostaglandin D (DP) receptors in human corpus cavernosum smooth muscle.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12230502 2002 Association of a new-type prostaglandin D2 receptor CRTH2 with circulating T helper 2 cells in patients with atopic dermatitis.
12119603 2002 A major susceptibility gene for asthma maps to chromosome 14q24.
12036966 2002 Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.
12002745 2002 New polymorphisms of haematopoietic prostaglandin D synthase and human prostanoid DP receptor genes.
11742277 2001 Selective modulation of chemokinesis, degranulation, and apoptosis in eosinophils through the PGD2 receptors CRTH2 and DP.
11139429 2000 The human prostanoid DP receptor stimulates mucin secretion in LS174T cells.
11082108 2000 Pharmacology and autoradiography of human DP prostanoid receptors using [(3)H]-BWA868C, a DP receptor-selective antagonist radioligand.
10827082 2000 Amino acid residues conferring ligand binding properties of prostaglandin I and prostaglandin D receptors. Identification by site-directed mutagenesis.
8833158 1996 Mapping of the genes encoding mouse prostaglandin D, E, and F and prostacyclin receptors.
7642548 1995 Molecular cloning and characterization of the human prostanoid DP receptor.
6302737 1983 Pharmacological and cardiovascular properties of a hydantoin derivative, BW 245 C, with high affinity and selectivity for PGD2 receptors.
1422574 1992 In vitro characterization of prostanoid FP-, DP-, IP- and TP-receptors on the non-pregnant human myometrium.