Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.32
PubTator Score 3.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus 1.500 1.3e-03
group 3 medulloblastoma 2.200 1.4e-03
intraductal papillary-mucinous adenoma (... 1.200 4.9e-03
intraductal papillary-mucinous carcinoma... 1.200 2.8e-02
osteosarcoma -1.380 8.1e-05
ovarian cancer -2.300 7.9e-05

Gene RIF (2)

AA Sequence

MDFVRLARLFARARPMGLFILQHLDPCRARWAGGREGLMRPMWAPFSSSSSQLPLGQERQENTGSLGSDP      1 - 70
SHSNSTATQEEDEEEEESFGTLSDKYSSRRLFRKSAAQFHNLRFGERRDEQMEPEPKLWRGRRNTPYWYF     71 - 140
LQCKHLIKEGKLVEALDLFERQMLKEERLQPMESNYTVLIGGCGRVGYLKKAFNLYNQMKKRDLEPSDAT    141 - 210
YTALFNVCAESPWKDSALQSALKLRQQLQAKNFELNLKTYHALLKMAAKCADLRMCLDVFKEIIHKGHVV    211 - 280
TEETFSFLLMGCIQDKKTGFRYALQVWRLMLSLGLQPSRDSYNLLLVAARDCGLGDPQVASELLLKPREE    281 - 350
ATVLQPPVSRQRPRRTAQAKAGNLMSAMLHVEALERQLFLEPSQALGPPEPPEARVPGKAQPEVDTKAEP    351 - 420
SHTAALTAVALKPPPVELEVNLLTPGAVPPTVVSFGTVTTPADRLALIGGLEGFLSKMAEHRQQPDIRTL    421 - 490
TLLAEVVESGSPAESLLLALLDEHQVEADLTFFNTLVRKKSKLGDLEGAKALLPVLAKRGLVPNLQTFCN    491 - 560
LAIGCHRPKDGLQLLTDMKKSQVTPNTHIYSALINAAIRKLNYTYLISILKDMKQNRVPVNEVVIRQLEF    561 - 630
AAQYPPTFDRYQGKNTYLEKIDGFRAYYKQWLTVMPAEETPHPWQKFRTKPQGDQDTGKEADDGCALGGR    631 - 700
//

Text Mined References (16)

PMID Year Title