Property Summary

NCBI Gene PubMed Count 14
PubMed Score 21.70
PubTator Score 18.82

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
26657638 Data show that polypyrimidine tract-binding proteins nPTB and ROD1 interact with mitochondrial tRNA(Thr) in the cytoplasm outside of mitochondria.
25119103 PTBP3 may promote proliferation and inhibit the differentiation of human gastric cancer MKN45 cells
23024754 ROD1 is a bona fide seedless target of miR-210.
22575643 ROD1 and UPF1 associate with a significant number of common transcripts.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19441079 Regulator of differentiation 1 (ROD1) binds to the amphipathic C-terminal peptide of thrombospondin-4 and is involved in its mitogenic activity.

AA Sequence

MDGVVTDLITVGLKRGSDELLSSGIINGPFTMNSSTPSTANGNDSKKFKRDRPPCSPSRVLHLRKIPCDV      1 - 70
TEAEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMVNYYTPITPHLRSQPVYIQYSNHRELKTDN     71 - 140
LPNQARAQAALQAVSAVQSGSLALSGGPSNEGTVLPGQSPVLRIIIENLFYPVTLEVLHQIFSKFGTVLK    141 - 210
IITFTKNNQFQALLQYADPVNAHYAKMALDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDFTRLDLPT    211 - 280
GDGQPSLEPPMAAAFGAPGIISSPYAGAAGFAPAIGFPQATGLSVPAVPGALGPLTITSSAVTGRMAIPG    281 - 350
ASGIPGNSVLLVTNLNPDLITPHGLFILFGVYGDVHRVKIMFNKKENALVQMADANQAQLAMNHLSGQRL    351 - 420
YGKVLRATLSKHQAVQLPREGQEDQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVTVDD    421 - 490
LKNLFIEAGCSVKAFKFFQKDRKMALIQLGSVEEAIQALIELHNHDLGENHHLRVSFSKSTI            491 - 552
//

Text Mined References (21)

PMID Year Title
26657638 2016 Human polypyrimidine tract-binding protein interacts with mitochondrial tRNA(Thr) in the cytosol.
25119103 2014 The effects of PTBP3 silencing on the proliferation and differentiation of MKN45 human gastric cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23024754 2012 ROD1 is a seedless target gene of hypoxia-induced miR-210.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22575643 2012 A new function of ROD1 in nonsense-mediated mRNA decay.
21269460 2011 Initial characterization of the human central proteome.
20937273 2010 MALAT-1 enhances cell motility of lung adenocarcinoma cells by influencing the expression of motility-related genes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19441079 2009 Regulator of differentiation 1 (ROD1) binds to the amphipathic C-terminal peptide of thrombospondin-4 and is involved in its mitogenic activity.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18335065 2008 Expression of human nPTB is limited by extreme suboptimal codon content.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10207106 1999 Isolation of a mammalian homologue of a fission yeast differentiation regulator.