Property Summary

NCBI Gene PubMed Count 32
PubMed Score 105.99
PubTator Score 29.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis -1.200 3.1e-06
osteosarcoma 3.353 2.1e-04
group 4 medulloblastoma 3.600 9.4e-07
cystic fibrosis -1.348 2.2e-04
medulloblastoma, large-cell 2.000 4.4e-05
primitive neuroectodermal tumor 1.100 6.1e-03
tuberculosis and treatment for 6 months 1.300 5.3e-03
colon cancer -1.300 4.0e-04
lung cancer 1.700 7.6e-05
subependymal giant cell astrocytoma -1.821 4.5e-02
nasopharyngeal carcinoma 1.200 8.0e-04
Pick disease -1.900 1.3e-05
dermatomyositis 1.200 1.9e-03

Gene RIF (12)

PMID Text
26657638 Data show that polypyrimidine tract-binding proteins nPTB and ROD1 interact with mitochondrial tRNA(Thr) in the cytoplasm outside of mitochondria.
26416554 PTBP1 and PTBP2 impaired autoregulation of SRSF3 in oral squamous cell carcinoma cancer cells.
25025966 MALAT1 binds to SFPQ releasing PTBP2 from the SFPQ/PTBP2 complex, the increased SFPQ-detached PTBP2 promotes cell proliferation and migration in colorectal cancer.
24286314 In T98G glioma cells, the level of sumoylated PTBP2 was reduced compared to that of normal brain cells. Overall, this study shows that PTBP2 is posttranslationally modified by SUMO1.
24264039 Defining the multifunctional roles of PTB will contribute to the understanding of key regulatory events in gene expression.
23174904 Changes in miR-223/PTBP2 pathway could contribute of abnormal splicing in chronic myeloid leukemia.
21282112 Regulation of the mutually exclusive exons 8a and 8 in the CaV1.2 calcium channel transcript by polypyrimidine tract-binding protein.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20160105 present fluorescence, NMR, and in vivo splicing data in support of a role of PTB in inducing RNA loops. We show that the RNA recognition motifs (RRMs) 3 and 4 of PTB can bind two distant pyrimidine tracts and bring their 5' and 3' ends in close proximity
17548433 Study shows that PTB can function as an anti-repressor molecule to counteract the splicing inhibitory activity of SRp30c.
16002244 The nPTB proximal promoter, although rich in G+C content and presenting putative binding sites for the transcription factors Sp1, NF-1, NF-kB and Oct-1, lacks a typical TATA box.
8626763 Polypyrimidine tract-binding protein (PTB) stimulates the binding of RNA Polymerase II and TRP-185 to HIV-1 TAR RNA, suggesting an interaction between PTB and HIV-1 Tat

AA Sequence

MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEV      1 - 70
TETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDN     71 - 140
TLNQRAQAVLQAVTAVQTANTPLSGTTVSESAVTPAQSPVLRIIIDNMYYPVTLDVLHQIFSKFGAVLKI    141 - 210
ITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVNLNVKYNNDKSRDYTRPDLPSG    211 - 280
DGQPALDPAIAAAFAKETSLLAVPGALSPLAIPNAAAAAAAAAAGRVGMPGVSAGGNTVLLVSNLNEEMV    281 - 350
TPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQTVQLPRE    351 - 420
GLDDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVAEEDLRTLFANTGGTVKAFKFFQD    421 - 490
HKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKSTI                                 491 - 531
//

Text Mined References (37)

PMID Year Title
26657638 2016 Human polypyrimidine tract-binding protein interacts with mitochondrial tRNA(Thr) in the cytosol.
26416554 2015 PTBP1 and PTBP2 impaired autoregulation of SRSF3 in cancer cells.
25025966 2014 Long non-coding RNA MALAT1 promotes tumour growth and metastasis in colorectal cancer through binding to SFPQ and releasing oncogene PTBP2 from SFPQ/PTBP2 complex.
24688880 2014 Solution and crystal structures of a C-terminal fragment of the neuronal isoform of the polypyrimidine tract binding protein (nPTB).
24448406 2014 The splicing regulator PTBP2 controls a program of embryonic splicing required for neuronal maturation.
24286314 2014 Characterization of a novel posttranslational modification in polypyrimidine tract-binding proteins by SUMO1.
24264039 2013 New insights into functional roles of the polypyrimidine tract-binding protein.
23174904 2013 BCR-ABL mediated repression of miR-223 results in the activation of MEF2C and PTBP2 in chronic myeloid leukemia.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22688191 2012 Genome-wide association study in a Swedish population yields support for greater CNV and MHC involvement in schizophrenia compared with bipolar disorder.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22655688 Neuronal regulation of pre-mRNA splicing by polypyrimidine tract binding proteins, PTBP1 and PTBP2.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21282112 2011 Regulation of the mutually exclusive exons 8a and 8 in the CaV1.2 calcium channel transcript by polypyrimidine tract-binding protein.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20160105 2010 RNA looping by PTB: Evidence using FRET and NMR spectroscopy for a role in splicing repression.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19571811 2009 Common polygenic variation contributes to risk of schizophrenia and bipolar disorder.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19029303 2009 Control of c-myc mRNA stability by IGF2BP1-associated cytoplasmic RNPs.
18335065 2008 Expression of human nPTB is limited by extreme suboptimal codon content.
17548433 2007 hnRNP I/PTB can antagonize the splicing repressor activity of SRp30c.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16002244 2005 Identification and analysis of the human neural polypyrimidine tract binding protein (nPTB) gene promoter region.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667811 2004 Evolutionary conservation of a 2-kb intronic sequence flanking a tissue-specific alternative exon in the PTBP2 gene.
12667457 2003 The Apaf-1 internal ribosome entry segment attains the correct structural conformation for function via interactions with PTB and unr.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213192 2002 Alternative splicing of brain-specific PTB defines a tissue-specific isoform pattern that predicts distinct functional roles.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11694331 2001 Molecular cloning and characterization of human PTB-like protein: a possible retinal autoantigen of cancer-associated retinopathy.
11003644 2000 Cooperative assembly of an hnRNP complex induced by a tissue-specific homolog of polypyrimidine tract binding protein.