Property Summary

NCBI Gene PubMed Count 112
PubMed Score 385.26
PubTator Score 563.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.365 1.9e-03
Multiple myeloma 1.588 9.7e-06
astrocytoma 2.600 6.7e-06
ependymoma 2.400 1.7e-03
oligodendroglioma 1.800 2.4e-03
psoriasis 1.400 3.3e-04
glioblastoma 2.300 1.5e-03
osteosarcoma -1.611 2.8e-05
sonic hedgehog group medulloblastoma 2.100 2.6e-09
atypical teratoid / rhabdoid tumor 2.400 1.6e-07
medulloblastoma, large-cell 2.500 4.4e-06
primitive neuroectodermal tumor 1.500 2.3e-05
Duchenne muscular dystrophy 1.239 1.2e-07
autosomal dominant Emery-Dreifuss muscul... 1.034 4.5e-03
juvenile dermatomyositis 1.507 1.3e-13
acute quadriplegic myopathy 1.260 5.1e-06
diabetes mellitus -1.200 2.4e-02
pediatric high grade glioma 1.800 2.2e-10
pilocytic astrocytoma 1.300 3.2e-08
subependymal giant cell astrocytoma 1.041 4.7e-02
ovarian cancer 2.000 1.8e-05

MLP Assay (9)

AID Type Active / Inconclusive / Inactive Description
2417 screening 4338 / 28974 / 106428 High Content Assay for Compounds that inhibit the Assembly of the Perinucleolar Compartment
2431 summary 0 / 0 / 0 High Content Assay for Compounds that inhibit the Assembly of the Perinucleolar Compartment: Summary
2730 confirmatory 56 / 35 / 28 High Content Assay for Compounds that inhibit the Assembly of the Perinucleolar Compartment: Confirmation of PNC Inhibition
2731 confirmatory 0 / 13 / 106 High Content Assay for Compounds that inhibit the Assembly of the Perinucleolar Compartment: PC3M Caspase 3/7 Activation
2733 confirmatory 35 / 55 / 29 High Content Assay for Compounds that inhibit the Assembly of the Perinucleolar Compartment: PC3M Cytotoxicity
2734 confirmatory 8 / 90 / 21 High Content Assay for Compounds that inhibit the Assembly of the Perinucleolar Compartment: DNA Intercalation/PicoGreen Displacement Assay
588722 other 8 / 0 / 3 High Content Assay for Compounds that inhibit the Assembly of the Perinucleolar Compartment:Cell Migration
588739 other 0 / 0 / 0 High Content Assay for Compounds that inhibit the Assembly of the Perinucleolar Compartment:Soft Agar Assay
588740 confirmatory 1 / 0 / 0 PC3M Cytotoxicity Assay for Compounds that Inhibit the Perinuclear Compartment: SAR

Gene RIF (72)

PMID Text
26744779 The polypyrimidine tract binding protein 1 (PTBP1) shields specific retroviral and cellular transcripts from nonsense-mediated mRNA decay.
26416554 PTBP1 and PTBP2 impaired autoregulation of SRSF3 in oral squamous cell carcinoma cancer cells.
26339049 HUR competes with the host protein PTB, which is a negative regulator of hepatitis C virus replication.
26336992 Results suggest that the role of polypyrimidine tract binding protein 1 (PTBP1) in tumorigenesis may be partly mediated by its regulation of cdc42 GTP-binding protein (CDC42) alternative splicing and CDC42-v2 might function as a tumor suppressor.
26234680 findings point to PKM2 and PTBP1 as new potential therapeutic targets to improve response of PDAC to chemotherapy
26047657 Data show that the protein levels of polypyrimidine tract binding protein 1 (PTBP1) and adenosine deaminase RNA-specific binding protein ADAR1 were cooperatively expressed in glioma tissues and cells.
25927630 impact of PTBP1 rs11085226 on glucose-stimulated insulin release
25904505 Data indicate that polypyrimidine tract-binding protein (PTBP1) is preferentially overexpressed in clinical colorectal cancers
25818238 Suggest that miR-124 acts as a tumor-suppressor and a modulator of energy metabolism through a PTB1/PKM1/PKM2 feedback cascade in human colorectal tumor cells.
25800779 protein knockdown enhances neurogenesis
25721733 Organ-specific PTB1-associated microRNAs determine expression of pyruvate kinase isoforms
25524026 RBFOX proteins can facilitate the splicing of micro-exons. We also found that PTBP1 likely regulates the inclusion of micro-exons, possibly by repressing the inclusion of micro-exons that are enhanced by RBFOX proteins and other splicing factors.
25496916 Polypyrimidine tract binding protein 1 (PTBP1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
25411246 IL-7 elevates miR-124 to decrease the expression of splicing regulator PTB and represses CD95 mRNA splicing.
25406089 PTB/hnRNP1 binds to the 3'UTR of Human Astrovirus-8 and is required or participates in viral replication.
25403273 ABLIM1 splicing is regulated by several splice factors, including MBNL family proteins, CELF1, 2 and 6, and PTBP1, using a cellular splicing assay.
24743263 PTBP1 and hnRNP C repress exon 3 inclusion, and that downregulation of PTBP1 inhibited BIM-mediated apoptosis.
24418535 PCBP2 and PTB are differentially cleaved by human rhinovirus proteinase in infected cells.
24141718 Polypyrimidine tract-binding protein function is controlled by a set of co-recruited proteins and importantly provide further evidence that it is possible to dictate cell fate by modulating cytoplasmic gene expression pathways alone.
23313552 Study reports that repression of a single RNA binding polypyrimidine-tract-binding (PTB) protein, which occurs during normal brain development via the action of miR-124, is sufficient to induce trans-differentiation of fibroblasts into functional neurons.
23077502 conclude that common genetic variation in PTBP1 influences glucose-stimulated insulin secretion. This underlines the importance of PTBP1 for beta cell function in vivo
22944692 Polypyrimidine tract binding protein 1 (PTBP1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
22705452 PTB depletion in the dorsal telencephalon is causally involved in the development of hydrocephalus. And PTB is important for the maintenance of Adherens Junctions in the neural stem cells of the dorsal telencephalon.
22427970 Polypyrimidine tract binding protein (hnRNP I) is possibly a conserved modulator of miRNA-mediated gene regulation.
22125086 The defective splicing caused by the ISCU intron mutation in patients with myopathy with lactic acidosis is repressed by PTBP1 but can be derepressed by IGF2BP1.
21980057 PTB is shown to bind an exonic splicing silencer element and repress alternative splicing of FADS2
21976412 Production of the USP5 isoform 2 was strongly correlated with PTBP1 expression in glioblastoma tumor samples and cell lines.
21518792 RBM4 may synergize its effect on muscle cell-specific alternative splicing by down-regulating PTB expression and antagonizing the activity of PTB in exon selection
21411518 Silencing the expression of PTB with small interfering RNA in two cell lines (Huh7 and HEK 293T) led to a significant increase of up to 4-fold in mRNA levels and virus titer, indicating a negative effect of PTB on coronavirus RNA accumulation.
21362553 U1 snRNA directly interacts with polypyrimidine tract-binding protein during splicing repression
21242519 Differentially modified PTB regulates CD40L expression at multiple steps by retaining CD40L mRNA in the nucleus, directly regulating mRNA stability at late times of activation, and forming a ribonuclear complex.
21054383 PTBP1 regulates the alternative splicing of dopamine D2 receptor.
20190818 a strong correlation between the expression of PTB-1, YB-1 and c-myc in multiple myeloma-derived cell lines
20080103 The slow backbone dynamics of PTB1:34, induced by packing of (RNA recognition motifs) RRM3 and RRM4, could be essential for high-affinity binding to a flexible polypyrimidine tract RNA and also provide entropic compensation for its own formation.
20071487 It appears that the polypyrimidine tract-binding protein might help in circularization of the coxsackievirus B3 RNA by bridging the ends necessary for efficient translation of the viral RNA.
20064465 Data suggest a mechanism for PTB to modulate splice site competition to produce opposite functional consequences, which may be generally applicable to RNA-binding splicing factors to regulate alternative splicing in mammalian cells.
19889140 The combined results suggest that 3C-mediated cleavage of PTB might be involved in down-regulation of viral translation to give way to subsequent viral genome replication.
19590510 PTB1 overexpression in cardiomyocytes induced caspase activity and caspase-dependent DNA fragmentation during ischemia, which is otherwise caspase-independent in differentiated cardiomyocytes.
19450550 This is the first study that enlightens the interaction of DENV NS4A protein with PTB, in addition to demonstrating the novel role of PTB in relation to mosquito-borne flavivirus life-cycle.
19226116 Since it can bind to short and long polypyrimidine tracts, structured or single-stranded, PTB takes on the role of a versatile adaptor protein that facilitates formation of mRNA-protein regulatory complexes.
19144709 polypyrimidine tract binding protein inhibits HCMV replication by interfering with major immediate-early (MIE) gene splicing through competition with U2AF for binding to the polypyrimidine tract in MIE gene introns.
18714005 in response to cellular activation in T cells and B cells, a PTB-containing stability complex forms that contains binding sites for Rab8A and cyclin D(2) transcripts and increases their mRNA half-lifes
18499661 PTB is not oncogenic and can either promote or antagonize a malignant trait dependent upon the specific intra-cellular environment
18335065 results provide a striking illustration of the importance of mRNA codon content in determining levels of PTB protein expression, even within cells of the natural host species
18216120 overexpression of polypyrimidine tract binding protein (PTB) induces HPV-16 late gene expression in cells transfected with subgenomic HPV-16 plasmids or with full-length HPV-16 genomes and in persistently HPV-16-infected cells.
18193060 Under polypyrimidine tract binding protein-mediated repression, assembly was arrested at an A-like complex that was unable to transition to spliceosomal complexes.
17936301 Improved segmental isotope labeling methods for the NMR study of multidomain large proteins: application to RNP L.
17592047 The results are consistent with a repressive mechanism in which cooperative binding of PTB to the PPT competes with binding of U2AF, thereby specifically blocking splicing of the alpha-actinin SM exon.
17507659 Identification of PSF, p54(nrb), PTB, and U1A as proteins specifically bound to the COX-2 polyadenylation signal upstream sequence elements .
17497933 Obtained results do give insights into PTB's affinity for different RNA sequences. The low-energy conformations of the complexes provided information about the mechanism of binding. The analysis showed that binding is not RNA sequence-specific
16885029 Data showed that polypyrimidine tract binding protein PTB, a known IRES trans-acting factor or ITAF, is pivotal in regulating the apoptotic process by controlling IRES function.
16765895 Small-angle X-ray scattering to determine the low-resolution structure of the entire PTB was used.
16362043 The structure of the two C-terminal RNA recognition motifs (RRM3 and RRM4) of PTB was studied.
16314454 PTBP1 is a monomer.
16282332 analysis of the splicing repressor domain in polypyrimidine tract-binding protein
16179478 solution structures of the four RNA binding domains (RBDs) of PTB; found that PTB is both a sequence-specific RNA binding protein with a preference for CU tracts and an RNA remodeler with an ability to bring separated pyrimidine tracts into proximity
15767428 upstream element in human papillomavirus type 16 interacted specifically with CstF-64, hnRNP C1/C2 & polypyrimidine tract binding protein, suggesting these factors were enhancing or regulating polyadenylation at the HPV-16 early polyadenylation signal
15669107 investigated the role of PTB for hepatitis C virus (HCV) translation, replication and chronic HCV infection; PTB inhibits HCV IRES-mediated translation but data do not indicate a significant role of PTB for HCV replication and chronic HCV infection
15341728 Data show that RNA recognition motifs (RRMs) 1 and 2 of polypyrimidine tract binding protein (PTB) contribute to RNA binding and that full-length PTB is monomeric, with an elongated structure consistent with a linear arrangement of RRMs.
15169918 The interactions of PTB-1 and PCBP1 with their cognate binding sites on the Bag-1 IRES disrupt many of the RNA-RNA interactions, and this creates a largely unstructured region of approximately 40 nucleotides that could permit ribosome binding.
14769134 Strong upregulation of PTB expression in tumor cells of glial or primitive neuroectodermal origin suggests involvement of this protein in cellular transformation.
12851456 nucleo-cytoplasmic transport of PTB is regulated by the 3',5'-cAMP-dependent protein kinase (PKA)
12667457 unr and nPTB act as RNA chaperones by changing the structure of the IRES into one that permits translation initiation
12581738 Proto-oncoprotein TLS/FUS is associated to the nuclear matrix and complexed with splicing factors PTB, SRm160, and SR proteins and plays a role in spliceosome assembly
12517964 PTB has been identified as a component of the putative complex involved in regulating the stability of CD154 mRNA at late times of T cell activation.
12449425 resonance assignment and topology of the 2H, 13C, 15N labelled 29 kDa N-terminal fragment
12004072 translation of some IRES-containing mRNAs is regulated by proteolytic cleavage of PTB during apoptosis
11788707 chemical shift mapping of RNA interactions with the polypyrimidine tract binding protein
11781313 PTB NES is a functionally important domain of this multifunctional protein that utilizes an unknown export receptor.
11739782 Nucleocytoplasmic shuttling of polypyrimidine tract-binding protein is uncoupled from RNA export
8883365 Polypyrimidine tract binding protein 1 (PTBP1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
8626763 Polypyrimidine tract binding protein 1 (PTBP1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS

AA Sequence

MDGIVPDIAVGTKRGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRVIHIRKLPIDV      1 - 70
TEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDS     71 - 140
SPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLRIIVENLFYPVTLDVLHQIFSKFGTV    141 - 210
LKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPDL    211 - 280
PSGDSQPSLDQTMAAAFGLSVPNVHGALAPLAIPSAAAAAAAAGRIAIPGLAGAGNSVLLVSNLNPERVT    281 - 350
PQSLFILFGVYGDVQRVKILFNKKENALVQMADGNQAQLAMSHLNGHKLHGKPIRITLSKHQNVQLPREG    351 - 420
QEDQGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLKVLFSSNGGVVKGFKFFQKD    421 - 490
RKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI                                 491 - 531
//

Text Mined References (124)

PMID Year Title
26744779 2016 Polypyrimidine tract binding protein 1 protects mRNAs from recognition by the nonsense-mediated mRNA decay pathway.
26416554 2015 PTBP1 and PTBP2 impaired autoregulation of SRSF3 in cancer cells.
26339049 2015 HuR Displaces Polypyrimidine Tract Binding Protein To Facilitate La Binding to the 3' Untranslated Region and Enhances Hepatitis C Virus Replication.
26336992 2015 Regulation and functional significance of CDC42 alternative splicing in ovarian cancer.
26234680 2016 Modulation of PKM alternative splicing by PTBP1 promotes gemcitabine resistance in pancreatic cancer cells.
26047657 2015 PTBP1 induces ADAR1 p110 isoform expression through IRES-like dependent translation control and influences cell proliferation in gliomas.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25927630 2015 Impact of PTBP1 rs11085226 on glucose-stimulated insulin release in adult Danes.
25904505 2015 Significance of Polypyrimidine Tract-Binding Protein 1 Expression in Colorectal Cancer.
25818238 2015 MicroRNA-124 inhibits cancer cell growth through PTB1/PKM1/PKM2 feedback cascade in colorectal cancer.
25800779 2015 The long noncoding RNA Pnky regulates neuronal differentiation of embryonic and postnatal neural stem cells.
25721733 2015 Organ-specific PTB1-associated microRNAs determine expression of pyruvate kinase isoforms.
25524026 2015 RBFOX and PTBP1 proteins regulate the alternative splicing of micro-exons in human brain transcripts.
25416956 2014 A proteome-scale map of the human interactome network.
25411246 2015 Interleukin 7 up-regulates CD95 protein on CD4+ T cells by affecting mRNA alternative splicing: priming for a synergistic effect on HIV-1 reservoir maintenance.
25406089 2014 PTB binds to the 3' untranslated region of the human astrovirus type 8: a possible role in viral replication.
25403273 2015 ABLIM1 splicing is abnormal in skeletal muscle of patients with DM1 and regulated by MBNL, CELF and PTBP1.
24743263 2014 Identification of cis-acting elements and splicing factors involved in the regulation of BIM Pre-mRNA splicing.
24418535 2014 Differential cleavage of IRES trans-acting factors (ITAFs) in cells infected by human rhinovirus.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24141718 2014 Remodelling of a polypyrimidine tract-binding protein complex during apoptosis activates cellular IRESs.
23313552 2013 Direct conversion of fibroblasts to neurons by reprogramming PTB-regulated microRNA circuits.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23077502 2012 Polymorphism rs11085226 in the gene encoding polypyrimidine tract-binding protein 1 negatively affects glucose-stimulated insulin secretion.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22705452 2013 PTB deficiency causes the loss of adherens junctions in the dorsal telencephalon and leads to lethal hydrocephalus.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22427970 2012 Polypyrimidine tract binding protein (hnRNP I) is possibly a conserved modulator of miRNA-mediated gene regulation.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22125086 2012 The defective splicing caused by the ISCU intron mutation in patients with myopathy with lactic acidosis is repressed by PTBP1 but can be derepressed by IGF2BP1.
21980057 2011 The polypyrimidine tract binding protein regulates desaturase alternative splicing and PUFA composition.
21976412 2012 PTBP1-dependent regulation of USP5 alternative RNA splicing plays a role in glioblastoma tumorigenesis.
21911577 2011 A physical interaction network of dengue virus and human proteins.
21518806 2011 Activation of picornaviral IRESs by PTB shows differential dependence on each PTB RNA-binding domain.
21518792 2011 RBM4 down-regulates PTB and antagonizes its activity in muscle cell-specific alternative splicing.
21411518 2011 The polypyrimidine tract-binding protein affects coronavirus RNA accumulation levels and relocalizes viral RNAs to novel cytoplasmic domains different from replication-transcription sites.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21362553 2011 U1 snRNA directly interacts with polypyrimidine tract-binding protein during splicing repression.
21269460 2011 Initial characterization of the human central proteome.
21242519 2011 Polypyrimidine tract-binding protein is critical for the turnover and subcellular distribution of CD40 ligand mRNA in CD4+ T cells.
21054383 2011 Polypyrimidine tract-binding protein 1 regulates the alternative splicing of dopamine receptor D2.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20190818 2010 Upregulated c-myc expression in multiple myeloma by internal ribosome entry results from increased interactions with and expression of PTB-1 and YB-1.
20080103 2010 Interactions between PTB RRMs induce slow motions and increase RNA binding affinity.
20071487 2010 Polypyrimidine tract-binding protein interacts with coxsackievirus B3 RNA and influences its translation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20064465 2009 Genome-wide analysis of PTB-RNA interactions reveals a strategy used by the general splicing repressor to modulate exon inclusion or skipping.
19946888 2010 Defining the membrane proteome of NK cells.
19889140 2010 Hepatitis A virus (HAV) proteinase 3C inhibits HAV IRES-dependent translation and cleaves the polypyrimidine tract-binding protein.
19590510 2009 Polypyrimidine tract binding proteins (PTB) regulate the expression of apoptotic genes and susceptibility to caspase-dependent apoptosis in differentiating cardiomyocytes.
19450550 2009 Polypyrimidine tract-binding protein influences negative strand RNA synthesis of dengue virus.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19226116 2009 The domains of polypyrimidine tract binding protein have distinct RNA structural preferences.
19144709 2009 Roles of polypyrimidine tract binding proteins in major immediate-early gene expression and viral replication of human cytomegalovirus.
18714005 2008 A polypyrimidine tract-binding protein-dependent pathway of mRNA stability initiates with CpG activation of primary B cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18499661 2008 Polypyrimidine tract-binding protein (PTB) differentially affects malignancy in a cell line-dependent manner.
18335065 2008 Expression of human nPTB is limited by extreme suboptimal codon content.
18216120 2008 Polypyrimidine tract binding protein induces human papillomavirus type 16 late gene expression by interfering with splicing inhibitory elements at the major late 5' splice site, SD3632.
18193060 2008 Polypyrimidine tract binding protein controls the transition from exon definition to an intron defined spliceosome.
17936301 2008 Improved segmental isotope labeling methods for the NMR study of multidomain or large proteins: application to the RRMs of Npl3p and hnRNP L.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17592047 2007 Repression of alpha-actinin SM exon splicing by assisted binding of PTB to the polypyrimidine tract.
17507659 2007 Specific trans-acting proteins interact with auxiliary RNA polyadenylation elements in the COX-2 3'-UTR.
17497933 2007 Mechanism and thermodynamics of binding of the polypyrimidine tract binding protein to RNA.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16885029 2006 Polypyrimidine tract binding protein regulates IRES-mediated gene expression during apoptosis.
16765895 2006 Conformation of polypyrimidine tract binding protein in solution.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16373488 2006 40LoVe interacts with Vg1RBP/Vera and hnRNP I in binding the Vg1-localization element.
16362043 2006 Structure of the two most C-terminal RNA recognition motifs of PTB using segmental isotope labeling.
16314454 2005 The polypyrimidine tract binding protein is a monomer.
16282332 2006 A splicing repressor domain in polypyrimidine tract-binding protein.
16260624 2005 Exon selection in alpha-tropomyosin mRNA is regulated by the antagonistic action of RBM4 and PTB.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16179478 2005 Structure of PTB bound to RNA: specific binding and implications for splicing regulation.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15975576 2005 Mass spectroscopy identifies the splicing-associated proteins, PSF, hnRNP H3, hnRNP A2/B1, and TLS/FUS as interacting partners of the ZNF198 protein associated with rearrangement in myeloproliferative disease.
15767428 2005 A 57-nucleotide upstream early polyadenylation element in human papillomavirus type 16 interacts with hFip1, CstF-64, hnRNP C1/C2, and polypyrimidine tract binding protein.
15669107 2004 Polypyrimidine tract-binding protein (PTB) inhibits Hepatitis C virus internal ribosome entry site (HCV IRES)-mediated translation, but does not affect HCV replication.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15341728 2004 Structure and RNA interactions of the N-terminal RRM domains of PTB.
15169918 2004 Bag-1 internal ribosome entry segment activity is promoted by structural changes mediated by poly(rC) binding protein 1 and recruitment of polypyrimidine tract binding protein 1.
15057824 2004 The DNA sequence and biology of human chromosome 19.
15039777 2004 Polypyrimidine tract-binding protein promotes insulin secretory granule biogenesis.
15009664 2004 Tau exon 10, whose missplicing causes frontotemporal dementia, is regulated by an intricate interplay of cis elements and trans factors.
14769134 2004 Expression of the splicing regulator polypyrimidine tract-binding protein in normal and neoplastic brain.
12851456 2003 Protein kinase A phosphorylation modulates transport of the polypyrimidine tract-binding protein.
12667457 2003 The Apaf-1 internal ribosome entry segment attains the correct structural conformation for function via interactions with PTB and unr.
12581738 2003 Proto-oncoprotein TLS/FUS is associated to the nuclear matrix and complexed with splicing factors PTB, SRm160, and SR proteins.
12527772 2003 Polypyrimidine tract binding protein and poly r(C) binding protein 1 interact with the BAG-1 IRES and stimulate its activity in vitro and in vivo.
12517964 2003 A complex containing polypyrimidine tract-binding protein is involved in regulating the stability of CD40 ligand (CD154) mRNA.
12509450 2003 Delineation of a novel pathway that regulates CD154 (CD40 ligand) expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12449425 2002 Resonance assignment and topology of the 2H, 13C, 15N labelled 29 kDa N-terminal fragment of the polypyrimidine tract binding protein (PTB).
12388589 2002 A receptor for activated C kinase is part of messenger ribonucleoprotein complexes associated with polyA-mRNAs in neurons.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
12213192 2002 Alternative splicing of brain-specific PTB defines a tissue-specific isoform pattern that predicts distinct functional roles.
12004072 2002 Polypyrimidine tract-binding proteins are cleaved by caspase-3 during apoptosis.
11781313 2002 Characterization of the nuclear export signal of polypyrimidine tract-binding protein.
11739782 2001 Nucleocytoplasmic shuttling of polypyrimidine tract-binding protein is uncoupled from RNA export.
11724819 2001 Raver1, a dual compartment protein, is a ligand for PTB/hnRNPI and microfilament attachment proteins.
11602719 2001 Role of polypyrimidine tract binding protein in the function of the hepatitis B virus posttranscriptional regulatory element.
11514619 2001 Nuclear relocalization of the pre-mRNA splicing factor PSF during apoptosis involves hyperphosphorylation, masking of antigenic epitopes, and changes in protein interactions.
11060040 2000 Human pre-mRNA cleavage factor II(m) contains homologs of yeast proteins and bridges two other cleavage factors.
11024286 2000 Organization of the human gene encoding heterogeneous nuclear ribonucleoprotein type I (hnRNP I) and characterization of hnRNP I related pseudogene.
11003644 2000 Cooperative assembly of an hnRNP complex induced by a tissue-specific homolog of polypyrimidine tract binding protein.
10856256 2000 Structure of tandem RNA recognition motifs from polypyrimidine tract binding protein reveals novel features of the RRM fold.
10772858 2000 Protein-protein interaction among hnRNPs shuttling between nucleus and cytoplasm.
10653975 2000 Differential nuclear localization and nuclear matrix association of the splicing factors PSF and PTB.
9563502 1998 Polypyrimidine tract-binding protein interacts with HnRNP L.
9512476 1998 Determination of functional domains in polypyrimidine-tract-binding protein.
9166399 1997 The dynamic organization of the perinucleolar compartment in the cell nucleus.
8883365 1996 Specific binding of polypyrimidine tract binding protein and hnRNP A1 to HIV-1 CRS elements.
8626763 1996 Identification of a group of cellular cofactors that stimulate the binding of RNA polymerase II and TRP-185 to human immunodeficiency virus 1 TAR RNA.
8449401 1993 Cloning and characterization of PSF, a novel pre-mRNA splicing factor.
7558043 1995 Assignment of the human gene encoding heterogeneous nuclear RNA ribonucleoprotein I (PTB) to chromosome 14q23-q24.1.
1906036 1991 Characterization and molecular cloning of polypyrimidine tract-binding protein: a component of a complex necessary for pre-mRNA splicing.
1906035 1991 Characterization of cDNAs encoding the polypyrimidine tract-binding protein.
1641332 1992 hnRNP I, the polypyrimidine tract-binding protein: distinct nuclear localization and association with hnRNAs.
1286667 1992 Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes.