Property Summary

NCBI Gene PubMed Count 12
PubMed Score 21.75
PubTator Score 12.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Bipolar Disorder 646
Disease Target Count P-value
osteosarcoma 7766 1.0e-09
Disease Target Count Z-score Confidence
Hirschsprung's disease 44 3.868 1.9
Parkinson's disease 378 3.439 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.042 1.0e-09

Gene RIF (6)

AA Sequence

MAVGKFLLGSLLLLSLQLGQGWGPDARGVPVADGEFSSEQVAKAGGTWLGTHRPLARLRRALSGPCQLWS      1 - 70
LTLSVAELGLGYASEEKVIFRYCAGSCPRGARTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDRHR     71 - 140
WQRLPQLSAAACGCGG                                                          141 - 156
//

Text Mined References (12)

PMID Year Title