Property Summary

NCBI Gene PubMed Count 3
PubMed Score 55.82
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Serine deficiency 9 6.672 3.3
Microcephaly 166 3.067 1.5

Gene RIF (1)

AA Sequence

MASASCSPGGALASPEPGRKILPRMISHSELRKLFYSADAVCFDVDSTVISEEGIGCFHWIWRKCDQATS      1 - 70
QG                                                                         71 - 72
//

Text Mined References (3)

PMID Year Title