Property Summary

NCBI Gene PubMed Count 25
PubMed Score 43.47
PubTator Score 30.78

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.300 4.2e-07
group 3 medulloblastoma 2.000 5.0e-03
atypical teratoid / rhabdoid tumor -1.200 4.9e-04
glioblastoma -1.400 3.2e-05
adult high grade glioma -1.100 2.2e-02
aldosterone-producing adenoma -1.209 1.5e-02
psoriasis -1.100 6.3e-12
spina bifida -1.470 4.2e-02
Pick disease -1.200 2.2e-05
ovarian cancer 2.300 3.0e-05

Gene RIF (5)

PMID Text
22416126 The crystal structure of the heterodimer of the multidomain conserved region of the Drosophila behavior/human splicing proteins, PSPC1 and NONO, is described.
22174317 HIV-1 Rev interacting protein, paraspeckle protein 1 (PSPC1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with PSPC1 is increased by RRE
22102035 crystal of PSPC1-NONO contained one heterodimer in the asymmetric unit and diffracted to 1.9 A resolution using synchrotron radiation
21532345 downregulated were the a protein coding gene PSPC1 in breast and ovarian cancer cells
16148043 We map the domain within PSP1 that is mediating this interaction and show it is required for the correct localization of PSP1 to paraspeckles. This interaction is necessary but not sufficient for paraspeckle targeting by PSP1

AA Sequence

MMLRGNLKQVRIEKNPARLRALESAVGESEPAAAAAMALALAGEPAPPAPAPPEDHPDEEMGFTIDIKSF      1 - 70
LKPGEKTYTQRCRLFVGNLPTDITEEDFKRLFERYGEPSEVFINRDRGFGFIRLESRTLAEIAKAELDGT     71 - 140
ILKSRPLRIRFATHGAALTVKNLSPVVSNELLEQAFSQFGPVEKAVVVVDDRGRATGKGFVEFAAKPPAR    141 - 210
KALERCGDGAFLLTTTPRPVIVEPMEQFDDEDGLPEKLMQKTQQYHKEREQPPRFAQPGTFEFEYASRWK    211 - 280
ALDEMEKQQREQVDRNIREAKEKLEAEMEAARHEHQLMLMRQDLMRRQEELRRLEELRNQELQKRKQIQL    281 - 350
RHEEEHRRREEEMIRHREQEELRRQQEGFKPNYMENREQEMRMGDMGPRGAINMGDAFSPAPAGNQGPPP    351 - 420
MMGMNMNNRATIPGPPMGPGPAMGPEGAANMGTPMMPDNGAVHNDRFPQGPPSQMGSPMGSRTGSETPQA    421 - 490
PMSGVGPVSGGPGGFGRGSQGGNFEGPNKRRRY                                         491 - 523
//

Text Mined References (35)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22416126 2012 Structure of the heterodimer of human NONO and paraspeckle protein component 1 and analysis of its role in subnuclear body formation.
22102035 2011 Crystallization of a paraspeckle protein PSPC1-NONO heterodimer.
21532345 LSINCT5 is over expressed in breast and ovarian cancer and affects cellular proliferation.
21269460 2011 Initial characterization of the human central proteome.
21144806 2011 Sequences in PSF/SFPQ mediate radioresistance and recruitment of PSF/SFPQ-containing complexes to DNA damage sites in human cells.
20974138 2010 The nuclear ATPase/adenylate kinase hCINAP is recruited to perinucleolar caps generated upon RNA pol.II inhibition.
20881053 2010 Highly ordered spatial organization of the structural long noncoding NEAT1 RNAs within paraspeckle nuclear bodies.
20573717 2010 Paraspeckles.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19720872 2009 Paraspeckles: nuclear bodies built on long noncoding RNA.
19716791 2009 Altered nuclear retention of mRNAs containing inverted repeats in human embryonic stem cells: functional role of a nuclear noncoding RNA.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19217333 2009 An architectural role for a nuclear noncoding RNA: NEAT1 RNA is essential for the structure of paraspeckles.
19188602 2009 MENepsilon/beta noncoding RNAs are essential for structural integrity of nuclear paraspeckles.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16148043 2005 P54nrb forms a heterodimer with PSP1 that localizes to paraspeckles in an RNA-dependent manner.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11790299 2002 Paraspeckles: a novel nuclear domain.
11790298 2002 Directed proteomic analysis of the human nucleolus.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.