Property Summary

NCBI Gene PubMed Count 13
PubMed Score 10.76
PubTator Score 23.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Multiple myeloma 1332 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 2.1e-09
Atopic dermatitis 952 6.2e-07
medulloblastoma, large-cell 6241 5.0e-04
Disease Target Count Z-score Confidence
Peeling skin syndrome 17 5.349 2.7
Xeroderma pigmentosum group A 4 3.466 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
Atopic dermatitis -2.700 6.2e-07
medulloblastoma, large-cell 1.300 5.0e-04
ovarian cancer 1.100 2.1e-09

Gene RIF (5)

AA Sequence

MILNWKLLGILVLCLHTRGISGSEGHPSHPPAEDREEAGSPTLPQGPPVPGDPWPGAPPLFEDPPPTRPS      1 - 70
RPWRDLPETGVWLPEPPRTDPPQPPRPDDPWPAGPQPPENPWPPAPEVDNRPQEEPDLDPPREEYR         71 - 136
//

Text Mined References (15)

PMID Year Title