1. Home
  2. Targets
  3. Psoriasis susceptibility 1 candidate gene 1 protein

Tbio Psoriasis susceptibility 1 candidate gene 1 protein

This gene is one of several genes thought to confer susceptibility to psoriasis and systemic sclerosis, located on chromosome 6 near the major histocompatibility complex (MHC) class I region. [provided by RefSeq, Sep 2011]

 Comments

Property Summary

NCBI Gene PubMed Count 28
PubMed Score 10.40
PubTator Score 6.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
malignant mesothelioma 3163 2.38792869280007E-6

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.600 0.000

Synonym

Accession Q9UIG5 B0V083 Q5ST21 Q86WJ8 Q86WJ9 Q96QC3
Symbols SEEK1
C6orf16

Gene

PSORS1C1

  Ortholog (1)

Species Source
Chimp OMA Inparanoid

 Compartment GO Term (1)

 GWAS Trait (13)

See all...

 HCA RNA Cell Line (21)

See all...

Pathway (1)

 UniProt Keyword (4)

Gene RIF (13)

PMID Text
24406073 The association has been found between PSORS1C1 SNPs and asthma in Hispanic Americans.
24210685 PSORS1C1/CDSN gene may play a pathogenic role in ankylosing spondylitis
23769905 this study demonstrates that SNPs in the PSORS1C1-encoding gene have a strong association with RA.
22896740 PSORS1C1 comparison showed association with the complete set of systemic sclerosis patients and all the subsets except for the anti-centromere-positive patients but, the association was dependent on different HLA class II alleles.
22277675 Report PCR-RFLP genotyping assay for PSORS1C1 which is in linkage disequilibrium with HLA-B*58:01 and may be marker for allopurinol-related Stevens-Johnson syndrome/toxic epidermal necrolysis in Japanese.
19851445 Observational study of gene-disease association. (HuGE Navigator)
19115949 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
18976687 Observational study of gene-disease association. (HuGE Navigator)
16029332 Observational study of gene-disease association. (HuGE Navigator)
15708881 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence 

MTCTDQKSHSQRALGTQTPALQGPQLLNTDPSSEETRPPHVNPDRLCHMEPANHFWHAGDLQAMISKEFH      1 - 70
LAATQDDCRKGRTQEDILVPSSHPELFASVLPMAPEEAARLQQPQPLPPPSGIHLSASRTLAPTLLYSSP     71 - 140
PSHSPFGLSSLI                                                              141 - 152
//

Text Mined References (29)

PMID Year Title
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
24406073 2014 Genome-wide association study and admixture mapping identify different asthma-associated loci in Latinos: the Genes-environments & Admixture in Latino Americans study.
24210685 2014 PSORS1C1/CDSN is associated with ankylosing spondylitis.
23955597 2013 Common variation at 3q26.2, 6p21.33, 17p11.2 and 22q13.1 influences multiple myeloma risk.
23769905 2013 PSORS1C1 may be involved in rheumatoid arthritis.
23326239 2013 A genome-wide integrative genomic study localizes genetic factors influencing antibodies against Epstein-Barr virus nuclear antigen 1 (EBNA-1).
23263863 2013 GWAS of blood cell traits identifies novel associated loci and epistatic interactions in Caucasian and African-American children.
23144326 2012 Genome-wide association analysis of blood biomarkers in chronic obstructive pulmonary disease.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23001997 2012 Identification of a susceptibility locus in STAT4 for Behçet's disease in Han Chinese in a genome-wide association study.
More...