Property Summary

NCBI Gene PubMed Count 30
PubMed Score 10.95
PubTator Score 6.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Behcet Syndrome 21 0.0 0.0
Scleroderma, Systemic 13 0.0 0.0
Disease Target Count
Systemic scleroderma 60
Disease Target Count P-value
malignant mesothelioma 3232 2.4e-06

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.600 2.4e-06

Synonym

Accession Q9UIG5 B0V083 Q5ST21 Q86WJ8 Q86WJ9 Q96QC3
Symbols SEEK1
C6orf16

Gene

  Ortholog (1)

Species Source Disease
Inparanoid OMA

 Compartment GO Term (1)

Gene RIF (15)

AA Sequence

MTCTDQKSHSQRALGTQTPALQGPQLLNTDPSSEETRPPHVNPDRLCHMEPANHFWHAGDLQAMISKEFH      1 - 70
LAATQDDCRKGRTQEDILVPSSHPELFASVLPMAPEEAARLQQPQPLPPPSGIHLSASRTLAPTLLYSSP     71 - 140
PSHSPFGLSSLI                                                              141 - 152
//

Text Mined References (31)

PMID Year Title