Property Summary

NCBI Gene PubMed Count 22
PubMed Score 8.07
PubTator Score 13.82

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.300 2.2e-03
medulloblastoma, large-cell 1.900 5.4e-05
pancreatic ductal adenocarcinoma liver m... -1.033 1.3e-02
lung cancer 1.700 3.9e-03
colon cancer 1.100 1.2e-02
ovarian cancer 2.200 3.0e-05

Gene RIF (9)

PMID Text
27100087 RNA-seq evidence of biallelic expression of PSMG1 and 10 neighboring genes in at least one primary human tissue tested indicates that the expression of PSMG1 is uncoupled from the control of the maternally inherited 5mCpG imprints at the WRB differentially methylated region (DMR) in disomic controls or trisomy (Down syndrome) individuals.
22593026 PSMG1 mutation is associated with Crohn's disease.
21509594 PSMG1 gene expression is increased in classic variant of papillary thyroid carcinoma.
21079743 Data show that an additive gene-gene interaction involving TLR4, PSMG1, TNFRSF6B and IRGM was identified with CD.
18793612 DSCR2 was found to interact with PPARbeta and to inhibit it.
18758464 Genome-wide association study of gene-disease association. (HuGE Navigator)
16251969 two chaperones, designated proteasome assembling chaperone-1 (PAC1) and PAC2, form a heterodimer and are involved in the maturation of mammalian 20S proteasomes
15670775 Further, the results of intracellular localization studies and membrane fractionation assays indicate that DSCR2 is targeted to a cytoplasmic compartment as a soluble form.
15590417 The DSCR2 protein is associated with the endoplasmic reticulum; it is not an integral membrane protein and it is maintained on the cytoplasmic side of the ER by indirect interaction with the ER membrane or with another protein.

AA Sequence

MAATFFGEVVKAPCRAGTEDEEEEEEGRRETPEDREVRLQLARKREVRLLRRQTKTSLEVSLLEKYPCSK      1 - 70
FIIAIGNNAVAFLSSFVMNSGVWEEVGCAKLWNEWCRTTDTTHLSSTEAFCVFYHLKSNPSVFLCQCSCY     71 - 140
VAEDQQYQWLEKVFGSCPRKNMQITILTCRHVTDYKTSESTGSLPSPFLRALKTQNFKDSACCPLLEQPN    141 - 210
IVHDLPAAVLSYCQVWKIPAILYLCYTDVMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTN    211 - 280
EIQSNIYT                                                                  281 - 288
//

Text Mined References (31)

PMID Year Title
27100087 2016 Trisomy 21 Alters DNA Methylation in Parent-of-Origin-Dependent and -Independent Manners.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23969696 2013 Multiethnic meta-analysis of genome-wide association studies in >100 000 subjects identifies 23 fibrinogen-associated Loci but no strong evidence of a causal association between circulating fibrinogen and cardiovascular disease.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22593026 Pseudomonas infection in children with early-onset Crohn's disease: an association with a mutation close to PSMG1.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21509594 2011 Differential expression of a set of genes in follicular and classic variants of papillary thyroid carcinoma.
21300955 2011 Meta-analysis of genome-wide association studies in >80 000 subjects identifies multiple loci for C-reactive protein levels.
21269460 2011 Initial characterization of the human central proteome.
21079743 2010 Interaction of Crohn's disease susceptibility genes in an Australian paediatric cohort.
20062062 2010 Genome-wide association study of ankylosing spondylitis identifies non-MHC susceptibility loci.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19379481 2009 A transcriptional sketch of a primary human breast cancer by 454 deep sequencing.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
18793612 2008 Down syndrome critical region 2 protein inhibits the transcriptional activity of peroxisome proliferator-activated receptor beta in HEK293 cells.
18758464 2008 Loci on 20q13 and 21q22 are associated with pediatric-onset inflammatory bowel disease.
17707236 2007 20S proteasome assembly is orchestrated by two distinct pairs of chaperones in yeast and in mammals.
17189198 2006 Cooperation of multiple chaperones required for the assembly of mammalian 20S proteasomes.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16251969 2005 A heterodimeric complex that promotes the assembly of mammalian 20S proteasomes.
15670775 2005 Molecular and cellular characterization of the Down syndrome critical region protein 2.
15590417 DSCR2, a Down syndrome critical region protein, is localized to the endoplasmic reticulum of mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10872820 2000 Down syndrome critical region gene 2: expression during mouse development and in human cell lines indicates a function related to cell proliferation.
10830953 2000 The DNA sequence of human chromosome 21.
9784380 1998 Identification and characterization of a new gene from human chromosome 21 between markers D21S343 and D21S268 encoding a leucine-rich protein.