Property Summary

NCBI Gene PubMed Count 45
PubMed Score 21.13
PubTator Score 11.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma 1.200 1.2e-02
osteosarcoma -3.476 7.4e-10
posterior fossa group A ependymoma 1.400 1.7e-09
astrocytoma 2.000 8.9e-04
lung cancer 1.100 9.5e-03
ovarian cancer 1.400 1.6e-04
dermatomyositis 1.500 8.5e-04

 MGI Phenotype (1)

Protein-protein Interaction (5)

Gene RIF (32)

PMID Text
24770418 cellular roles and mechanisms of PI31 in regulation of proteasome function remain unclear and require future definition.
18495667 a model for FP domain-mediated dimerization of SCF(Fbxo7) and PI31
16146763 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
16046164 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
16035254 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
15638724 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
15183343 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
15139295 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14614829 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14564014 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14557625 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14550573 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14528301 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14528300 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14527406 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12970355 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12920286 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12914693 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12859895 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12840737 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12830140 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12809610 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12808466 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12808465 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12750511 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12719574 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12419264 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12167863 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
10893419 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
9846577 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
9811770 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
9079628 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway

AA Sequence

MAGLEVLFASAAPAITCRQDALVCFLHWEVVTHGYFGLGVGDQPGPNDKKSELLPAGWNNNKDLYVLRYE      1 - 70
YKDGSRKLLVKAITVESSMILNVLEYGSQQVADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIIT     71 - 140
PIHEQWEKANVSSPHREFPPATAREVDPLRIPPHHPHTSRQPPWCDPLGPFVVGGEDLDPFGPRRGGMIV    141 - 210
DPLRSGFPRALIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPPGPNPDHLPPPGYDDMYL             211 - 271
//

Text Mined References (55)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24770418 2014 Molecular and cellular roles of PI31 (PSMF1) protein in regulation of proteasome function.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18495667 2008 Structure of a conserved dimerization domain within the F-box protein Fbxo7 and the PI31 proteasome inhibitor.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16000308 2005 Novel interaction partners of the CD2BP2-GYF domain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15029244 2004 Mammalian Cdh1/Fzr mediates its own degradation.
14614829 2003 The Vif protein of HIV triggers degradation of the human antiretroviral DNA deaminase APOBEC3G.
14564014 2003 Induction of APOBEC3G ubiquitination and degradation by an HIV-1 Vif-Cul5-SCF complex.
14557625 2003 The human immunodeficiency virus type 1 Vif protein reduces intracellular expression and inhibits packaging of APOBEC3G (CEM15), a cellular inhibitor of virus infectivity.
14550573 2003 Human immunodeficiency virus-1 Tat protein interacts with distinct proteasomal alpha and beta subunits.
14528301 2003 HIV-1 Vif protein binds the editing enzyme APOBEC3G and induces its degradation.
14528300 2003 The antiretroviral enzyme APOBEC3G is degraded by the proteasome in response to HIV-1 Vif.
14527406 2003 HIV-1 Vif blocks the antiviral activity of APOBEC3G by impairing both its translation and intracellular stability.
12970355 2003 The enzymatic activity of CEM15/Apobec-3G is essential for the regulation of the infectivity of HIV-1 virion but not a sole determinant of its antiviral activity.
12920286 2003 Virology. Weapons of mutational destruction.
12914693 2003 Death by deamination: a novel host restriction system for HIV-1.
12859895 2003 Species-specific exclusion of APOBEC3G from HIV-1 virions by Vif.
12840737 2003 Good to CU.
12830140 2003 DNA deamination: not just a trigger for antibody diversification but also a mechanism for defense against retroviruses.
12809610 2003 DNA deamination mediates innate immunity to retroviral infection.
12808466 2003 Broad antiretroviral defence by human APOBEC3G through lethal editing of nascent reverse transcripts.
12808465 2003 The cytidine deaminase CEM15 induces hypermutation in newly synthesized HIV-1 DNA.
12791267 2003 Prophase destruction of Emi1 by the SCF(betaTrCP/Slimb) ubiquitin ligase activates the anaphase promoting complex to allow progression beyond prometaphase.
12750511 2003 Hypermutation of HIV-1 DNA in the absence of the Vif protein.
12719574 2003 Comprehensive investigation of the molecular defect in vif-deficient human immunodeficiency virus type 1 virions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12419264 2002 The RTP site shared by the HIV-1 Tat protein and the 11S regulator subunit alpha is crucial for their effects on proteasome function including antigen processing.
12374861 2002 PI31 is a modulator of proteasome formation and antigen processing.
12167863 2002 Isolation of a human gene that inhibits HIV-1 infection and is suppressed by the viral Vif protein.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11285280 2001 Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint.
10893419 2000 Degradation of HIV-1 integrase by the N-end rule pathway.
10764772 2000 cDNA cloning, expression, and functional characterization of PI31, a proline-rich inhibitor of the proteasome.
10363639 1999 The proteasome-dependent proteolytic system.
9846577 1998 Evidence for a newly discovered cellular anti-HIV-1 phenotype.
9811770 1998 An endogenous inhibitor of human immunodeficiency virus in human lymphocytes is overcome by the viral Vif protein.
9110174 1997 Large-scale concatenation cDNA sequencing.
9079628 1997 HIV-1 tat inhibits the 20 S proteasome and its 11 S regulator-mediated activation.
8619474 1996 A "double adaptor" method for improved shotgun library construction.