Property Summary

NCBI Gene PubMed Count 42
PubMed Score 24.66
PubTator Score 27.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
HIV Infections 102 0.0 0.0

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma 1.100 1.6e-02
Multiple myeloma 1.218 5.6e-04
non primary Sjogren syndrome sicca 1.600 1.5e-02
ovarian cancer 2.100 1.2e-05
pancreatic ductal adenocarcinoma liver m... -1.093 3.7e-02

Protein-protein Interaction (3)

PDB (15)

Gene RIF (25)

AA Sequence

MFIKGRAPRAPPRERRRATRGGLRQVVAPPRALGSTSRPHFRRASVCRRRCRKSGGLLAASRKMAAAAVN      1 - 70
GAAGFSSSGPAATSGAVLQAATGMYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQ     71 - 140
LILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHT    141 - 210
ELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYE    211 - 280
KILFTEATRILFFNTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV    281 - 350
//

Text Mined References (49)

PMID Year Title