Property Summary

NCBI Gene PubMed Count 42
PubMed Score 20.60
PubTator Score 27.48

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.218 5.6e-04
glioblastoma 1.100 1.6e-02
pancreatic ductal adenocarcinoma liver m... -1.093 3.7e-02
non primary Sjogren syndrome sicca 1.600 1.5e-02
ovarian cancer 2.100 1.2e-05

Synonym

Accession P48556 B4DX18 Q6P1L7
Symbols S14
p31
HIP6
HYPF
Nin1p
Rpn12
HEL-S-91n

Gene

PANTHER Protein Class (1)

PDB

5GJQ   5GJR   5L4K  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (25)

PMID Text
16885229 These findings support the hypothesis that neurodegenerative disorders result primarily from a generic cell dysfunction caused by early misfolded species in the aggregation process.
14614829 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14564014 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14557625 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14550573 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14528301 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14528300 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14527406 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12970355 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12920286 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12914693 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12859895 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12840737 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12830140 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12809610 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12808466 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12808465 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12750511 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12719574 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12419264 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
12167863 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
10893419 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
9846577 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
9811770 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
9079628 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway

AA Sequence

MFIKGRAPRAPPRERRRATRGGLRQVVAPPRALGSTSRPHFRRASVCRRRCRKSGGLLAASRKMAAAAVN      1 - 70
GAAGFSSSGPAATSGAVLQAATGMYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQ     71 - 140
LILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHT    141 - 210
ELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYE    211 - 280
KILFTEATRILFFNTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV    281 - 350
//

Text Mined References (45)

PMID Year Title
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17323924 2007 Mass spectrometric characterization of the affinity-purified human 26S proteasome complex.
16885229 2006 Prefibrillar amyloid aggregates could be generic toxins in higher organisms.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15057824 2004 The DNA sequence and biology of human chromosome 19.
15029244 2004 Mammalian Cdh1/Fzr mediates its own degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14614829 2003 The Vif protein of HIV triggers degradation of the human antiretroviral DNA deaminase APOBEC3G.
14564014 2003 Induction of APOBEC3G ubiquitination and degradation by an HIV-1 Vif-Cul5-SCF complex.
14557625 2003 The human immunodeficiency virus type 1 Vif protein reduces intracellular expression and inhibits packaging of APOBEC3G (CEM15), a cellular inhibitor of virus infectivity.
14550573 2003 Human immunodeficiency virus-1 Tat protein interacts with distinct proteasomal alpha and beta subunits.
14528301 2003 HIV-1 Vif protein binds the editing enzyme APOBEC3G and induces its degradation.
14528300 2003 The antiretroviral enzyme APOBEC3G is degraded by the proteasome in response to HIV-1 Vif.
14527406 2003 HIV-1 Vif blocks the antiviral activity of APOBEC3G by impairing both its translation and intracellular stability.
12970355 2003 The enzymatic activity of CEM15/Apobec-3G is essential for the regulation of the infectivity of HIV-1 virion but not a sole determinant of its antiviral activity.
12920286 2003 Virology. Weapons of mutational destruction.
12914693 2003 Death by deamination: a novel host restriction system for HIV-1.
12859895 2003 Species-specific exclusion of APOBEC3G from HIV-1 virions by Vif.
12840737 2003 Good to CU.
12830140 2003 DNA deamination: not just a trigger for antibody diversification but also a mechanism for defense against retroviruses.
12809610 2003 DNA deamination mediates innate immunity to retroviral infection.
12808466 2003 Broad antiretroviral defence by human APOBEC3G through lethal editing of nascent reverse transcripts.
12808465 2003 The cytidine deaminase CEM15 induces hypermutation in newly synthesized HIV-1 DNA.
12791267 2003 Prophase destruction of Emi1 by the SCF(betaTrCP/Slimb) ubiquitin ligase activates the anaphase promoting complex to allow progression beyond prometaphase.
12750511 2003 Hypermutation of HIV-1 DNA in the absence of the Vif protein.
12719574 2003 Comprehensive investigation of the molecular defect in vif-deficient human immunodeficiency virus type 1 virions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12419264 2002 The RTP site shared by the HIV-1 Tat protein and the 11S regulator subunit alpha is crucial for their effects on proteasome function including antigen processing.
12167863 2002 Isolation of a human gene that inhibits HIV-1 infection and is suppressed by the viral Vif protein.
11285280 2001 Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint.
11163772 2001 Identification of two proteins, S14 and UIP1, that interact with UCH37.
10893419 2000 Degradation of HIV-1 integrase by the N-end rule pathway.
9846577 1998 Evidence for a newly discovered cellular anti-HIV-1 phenotype.
9811770 1998 An endogenous inhibitor of human immunodeficiency virus in human lymphocytes is overcome by the viral Vif protein.
9079628 1997 HIV-1 tat inhibits the 20 S proteasome and its 11 S regulator-mediated activation.
8811196 1996 Structure and functions of the 20S and 26S proteasomes.
7621825 1995 Nin1p, a regulatory subunit of the 26S proteasome, is necessary for activation of Cdc28p kinase of Saccharomyces cerevisiae.