Property Summary

NCBI Gene PubMed Count 59
PubMed Score 13.02
PubTator Score 12.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 3.0e-05
lung cancer 4473 4.6e-04
ovarian cancer 8491 1.0e-03
intraductal papillary-mucinous neoplasm (IPMN) 3289 8.5e-03
Disease Target Count Z-score Confidence
Hereditary renal cell carcinoma 3 4.174 2.1

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 2.000 3.0e-05
intraductal papillary-mucinous neoplasm ... 1.200 8.5e-03
lung cancer 1.100 4.6e-04
ovarian cancer 1.900 1.0e-03

Synonym

Accession P51665 D3DWS9 Q6PKI2 Q96E97
Symbols P40
S12
Rpn8
MOV34

Gene

PDB

5GJQ   5GJR   5L4K   2O95   2O96  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 MGI Phenotype (1)

Gene RIF (32)

PMID Text
22190034 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 7 (PSMD7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20643764 SNP rs17336700 of a non-MHC ubiquitin-proteasome subunit PSMD7 is significantly associated with ankylosing spondylitis in Chinese population and the mRNA level of the PSMD7 gene in liver tissue increased when the rs17336700 C allele was present.
20643764 Observational study of gene-disease association. (HuGE Navigator)
19844255 Observational study of gene-disease association. (HuGE Navigator)
17559875 although the MPN domain of Mov34 shows a typical metalloprotease fold, it is unable to coordinate a metal ion.
16842755 MPN domain of Mov34 is highly resistant to proteolysis
15221960 data suggest a differential nuclear function of modified and unmodified S12 in cancer
14614829 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 7 (PSMD7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14564014 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 7 (PSMD7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14557625 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 7 (PSMD7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14550573 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 7 (PSMD7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14528301 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 7 (PSMD7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14528300 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 7 (PSMD7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14527406 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 7 (PSMD7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12970355 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 7 (PSMD7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12920286 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 7 (PSMD7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12914693 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 7 (PSMD7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12859895 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 7 (PSMD7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12840737 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 7 (PSMD7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12830140 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 7 (PSMD7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12809610 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 7 (PSMD7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12808466 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 7 (PSMD7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12808465 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 7 (PSMD7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12750511 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 7 (PSMD7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12719574 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 7 (PSMD7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12419264 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 7 (PSMD7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12237292 hVIP is a member of the complex array of nucleocytoplasmic shuttling proteins that are regulated by HIV infection and glucocorticoids
12167863 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 7 (PSMD7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
10893419 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 7 (PSMD7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
9846577 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 7 (PSMD7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
9811770 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 7 (PSMD7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
9079628 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 7 (PSMD7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFL      1 - 70
DHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYIS     71 - 140
VEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRS    141 - 210
YLEKVATGKLPINHQIIYQLQDVFNLLPDVSLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKI    211 - 280
ANRDAEKKEGQEKEESKKDRKEDKEKDKDKEKSDVKKEEKKEKK                              281 - 324
//

Text Mined References (63)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25389016 2014 ADAR1 enhances HTLV-1 and HTLV-2 replication through inhibition of PKR activity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22078707 2011 TRIM5? associates with proteasomal subunits in cells while in complex with HIV-1 virions.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
20643764 2011 A polymorphism rs17336700 in the PSMD7 gene is associated with ankylosing spondylitis in Chinese subjects.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19946888 2010 Defining the membrane proteome of NK cells.
19844255 2010 Fine mapping and association studies of a high-density lipoprotein cholesterol linkage region on chromosome 16 in French-Canadian subjects.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
17559875 2007 The crystal structure of the human Mov34 MPN domain reveals a metal-free dimer.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17323924 2007 Mass spectrometric characterization of the affinity-purified human 26S proteasome complex.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17028202 2006 The proteolytic function of the Arabidopsis 26S proteasome is required for specifying leaf adaxial identity.
16842755 2006 Characterization of the human ortholog of Mov34 reveals eight N-terminal residues important for MPN domain stability.
16396496 2006 Insulin-dependent interactions of proteins with GLUT4 revealed through stable isotope labeling by amino acids in cell culture (SILAC).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383276 2004 A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
15221960 2004 Post-translationally modified S12, absent in transformed breast epithelial cells, is not associated with the 26S proteasome and is induced by proteasome inhibitor.
15029244 2004 Mammalian Cdh1/Fzr mediates its own degradation.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14614829 2003 The Vif protein of HIV triggers degradation of the human antiretroviral DNA deaminase APOBEC3G.
14564014 2003 Induction of APOBEC3G ubiquitination and degradation by an HIV-1 Vif-Cul5-SCF complex.
14557625 2003 The human immunodeficiency virus type 1 Vif protein reduces intracellular expression and inhibits packaging of APOBEC3G (CEM15), a cellular inhibitor of virus infectivity.
14550573 2003 Human immunodeficiency virus-1 Tat protein interacts with distinct proteasomal alpha and beta subunits.
14528301 2003 HIV-1 Vif protein binds the editing enzyme APOBEC3G and induces its degradation.
14528300 2003 The antiretroviral enzyme APOBEC3G is degraded by the proteasome in response to HIV-1 Vif.
14527406 2003 HIV-1 Vif blocks the antiviral activity of APOBEC3G by impairing both its translation and intracellular stability.
12970355 2003 The enzymatic activity of CEM15/Apobec-3G is essential for the regulation of the infectivity of HIV-1 virion but not a sole determinant of its antiviral activity.
12944474 2003 Ataxin-3 interactions with rad23 and valosin-containing protein and its associations with ubiquitin chains and the proteasome are consistent with a role in ubiquitin-mediated proteolysis.
12920286 2003 Virology. Weapons of mutational destruction.
12914693 2003 Death by deamination: a novel host restriction system for HIV-1.
12859895 2003 Species-specific exclusion of APOBEC3G from HIV-1 virions by Vif.
12840737 2003 Good to CU.
12830140 2003 DNA deamination: not just a trigger for antibody diversification but also a mechanism for defense against retroviruses.
12809610 2003 DNA deamination mediates innate immunity to retroviral infection.
12808466 2003 Broad antiretroviral defence by human APOBEC3G through lethal editing of nascent reverse transcripts.
12808465 2003 The cytidine deaminase CEM15 induces hypermutation in newly synthesized HIV-1 DNA.
12791267 2003 Prophase destruction of Emi1 by the SCF(betaTrCP/Slimb) ubiquitin ligase activates the anaphase promoting complex to allow progression beyond prometaphase.
12750511 2003 Hypermutation of HIV-1 DNA in the absence of the Vif protein.
12719574 2003 Comprehensive investigation of the molecular defect in vif-deficient human immunodeficiency virus type 1 virions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12419264 2002 The RTP site shared by the HIV-1 Tat protein and the 11S regulator subunit alpha is crucial for their effects on proteasome function including antigen processing.
12368243 2002 Identification and confirmation of a module of coexpressed genes.
12237292 2002 Carboxyl terminus of hVIP/mov34 is critical for HIV-1-Vpr interaction and glucocorticoid-mediated signaling.
12167863 2002 Isolation of a human gene that inhibits HIV-1 infection and is suppressed by the viral Vif protein.
11285280 2001 Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint.
10893419 2000 Degradation of HIV-1 integrase by the N-end rule pathway.
9846577 1998 Evidence for a newly discovered cellular anti-HIV-1 phenotype.
9811770 1998 An endogenous inhibitor of human immunodeficiency virus in human lymphocytes is overcome by the viral Vif protein.
9520381 1998 HIV-1 Vpr interacts with a human 34-kDa mov34 homologue, a cellular factor linked to the G2/M phase transition of the mammalian cell cycle.
9079628 1997 HIV-1 tat inhibits the 20 S proteasome and its 11 S regulator-mediated activation.
8811196 1996 Structure and functions of the 20S and 26S proteasomes.
7755639 1995 cDNA cloning of p40, a regulatory subunit of the human 26S proteasome, and a homolog of the Mov-34 gene product.
6188845 1983 Immunochemical accessibility of ribosomal protein S4 in the 30 S ribosome. The interaction of S4 with S5 and S12.
2209467 1990 Molecular analysis of the Mov 34 mutation: transcript disrupted by proviral integration in mice is conserved in Drosophila.