Property Summary

NCBI Gene PubMed Count 98
PubMed Score 136.65
PubTator Score 90.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 2.6e-05
lung cancer 4740 1.8e-04
Multiple myeloma 1332 2.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.300 1.8e-04
Multiple myeloma 1.196 2.8e-03
ovarian cancer 2.000 2.6e-05

Synonym

Accession P55036 D3DV16 Q5VWC5 Q9NS92
Symbols AF
ASF
S5A
AF-1
MCB1
Rpn10
pUB-R5

Gene

PANTHER Protein Class (1)

PDB

5GJQ   5GJR   5LN3   5M32   5T0C   5T0G   5T0H   5T0I   5T0J   5VGZ   5VHF   5VHH   5VHI   5VHS   1UEL   1P9D   1YX5   1YX6   2KDF   5L4K   1P9C   1YX4   2KDE  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (57)

AA Sequence

MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGR      1 - 70
ILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDI     71 - 140
INFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGAMLGLGASDFEFGVDP    141 - 210
SADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATTGTEDSDDALLKMTISQQEFGRTGLPDLSS    211 - 280
MTEEEQIAYAMQMSLQGAEFGQAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNE    281 - 350
AIRNAMGSLASQATKDGKKDKKEEDKK                                               351 - 377
//

Text Mined References (112)

PMID Year Title