Property Summary

NCBI Gene PubMed Count 98
PubMed Score 136.65
PubTator Score 90.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 2.6e-05
lung cancer 4740 1.8e-04
Multiple myeloma 1332 2.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.300 1.8e-04
Multiple myeloma 1.196 2.8e-03
ovarian cancer 2.000 2.6e-05

PDB (23)

Gene RIF (57)

AA Sequence

MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGR      1 - 70
ILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDI     71 - 140
INFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGAMLGLGASDFEFGVDP    141 - 210
SADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATTGTEDSDDALLKMTISQQEFGRTGLPDLSS    211 - 280
MTEEEQIAYAMQMSLQGAEFGQAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNE    281 - 350
AIRNAMGSLASQATKDGKKDKKEEDKK                                               351 - 377
//

Text Mined References (112)

PMID Year Title