Property Summary

NCBI Gene PubMed Count 95
PubMed Score 133.81
PubTator Score 90.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 2.6e-05
lung cancer 4473 1.8e-04
Multiple myeloma 1327 2.8e-03

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.196 2.8e-03
lung cancer 1.300 1.8e-04
ovarian cancer 2.000 2.6e-05

Synonym

Accession P55036 D3DV16 Q5VWC5 Q9NS92
Symbols AF
ASF
S5A
AF-1
MCB1
Rpn10
pUB-R5

Gene

PANTHER Protein Class (1)

PDB

5GJQ   5GJR   1UEL   1P9D   1YX5   1YX6   2KDF   5L4K   1P9C   1YX4   2KDE  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (54)

PMID Text
26903513 regulation of NY-ESO-1 processing by the ubiquitin receptors Rpn10 and Rpn13 as a well as by the standard and immunoproteasome is governed by non-canonical ubiquitination on non-lysine sites.
25897558 Not only AF1, but an entire proteasome complex, seems to be present in blood.
25318673 The VWA domain regulation of ubiquitin and Ubl binding to S5a is restricted to the 26S proteasome.
24829148 binds to death receptor-6, and induces monocyte cell line differentiation via NF-kB pathway
24250289 To examine angiocidin expression in SMMC-7221 and HepG2 cells and the role of angiocidin in liver cancer cell growth. Angiocidin is highly expressed in liver cancer cells, and it may play a key role in tumor growth of liver cancers.
24121268 The degradation of TP53 and MDM2 by the proteasome can be selectively dependent on S5a in human cells.
24074603 One consequence of the interaction between E6/E6AP and S5a is enhanced ubiquitination of this proteasome subunit.
23966401 Authors demonstrate that human cytomegalovirus UL76 induces a novel nuclear aggresome, likely by subverting S5a of the ubiquitin-proteasome system.
23515276 These studies suggest that diminished 26S activity in failing human hearts may be related ti impaired docking of the 19S to the 20S as a result of decreased Rpt subunit ATPase activity and alpha7 subunit phosphorylation.
22434192 identified the VWA domain of hRpn10 as a receptor for ubiquitin-like proteins within the 26S proteasome and elucidated how FAT10 mediates efficient proteolysis by the proteasome
21628408 Both higher PSMD4 expression levels and higher 1q21 copy numbers affected clinical outcome adversely.
20614012 Pull-down analysis shows that S2 and S5a, two components of the 19S subunit of the 26S proteasome, interact with HIV-1 Vpr
20417181 results suggest that there is different substrate specificity between S5a and hRpn13 at the level of delivery and S5a may be the major docking site for ERAD substrates.
19875440 parkin Ubld uses differential surfaces to recruit UIM regions from the S5a proteasomal subunit compared with Eps15 involved in cell signaling.
19683493 The binding of S5a to K48-linked diubiquitin is defined at an atomic level resolution.
19519434 Angiocidin's ability to elicit tumor cell death may be mediated in part by it's pro-inflammatory effects on immune cells in the tumor microenvironment.
19387488 The presence of S5a in the reaction containing a substrate (luciferase), ubiquitination enzymes (an E2, UbcH5, and the U-box E3 ligase CHIP) and 26S proteasome significantly increased the rate of luciferase degradation.
18976975 Knockdown of proteasome (prosome, macropain) 26S subunit, non-ATPase, 4 (PSMD4) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18632645 angiocidin activates monocytes to secrete cytokines and differentiates them to a macrophage-like phenotype through at least two pathways mediated by MAPK and NF-kappaB, as well as PI3K
18207252 In autoimmune disorders like MS, angiocidin activates T cells, macrophages, microglia & astrocytes to produce inflammatory cytokines and to stimulate antigen presentation.
17949686 S5a-UIMs can be used as upstream inhibitors of the proteasome pathway.
17459097 results suggest that S5a is regulated during apoptosis at the transcriptional level and S5a upregulation by antiapoptotic signals can contribute to cell survival.
17408689 UIM2 domain of S5a binds preferentially to hHR23a over polyubiquitin, and a model is provided for the ternary complex that represents one of the mechanisms used by the proteasome to capture ubiquitylated substrates.
17327906 Overexpression of the S5a subunit of proteasome activator PA700 did not recover proteasome function in Huntington disease cells. S5a.
16762342 These results are consistent with the conclusion that the anti-tumor activity of angiocidin arises from its ability to ligate collagen and alpha2beta1 on endothelial cells and tumor cells.
15826667 Results report the structure of S5a (196-306) alone and complexed with two monoubiquitin molecules, and present a model for how S5a and other ubiquitin-binding proteins recognize polyubiquitin.
14614829 Pull-down analysis shows that S2 and S5a, two components of the 19S subunit of the 26S proteasome, interact with HIV-1 Vpr
14585839 structure of the ubiquitin-interacting motif of the proteasome subunit S5a bound to the ubiquitin-like domain of HR23B
14564014 Pull-down analysis shows that S2 and S5a, two components of the 19S subunit of the 26S proteasome, interact with HIV-1 Vpr
14557625 Pull-down analysis shows that S2 and S5a, two components of the 19S subunit of the 26S proteasome, interact with HIV-1 Vpr
14557549 HHr23a binds to this protein, which changes its own conformation.
14550573 Pull-down analysis shows that S2 and S5a, two components of the 19S subunit of the 26S proteasome, interact with HIV-1 Vpr
14528301 Pull-down analysis shows that S2 and S5a, two components of the 19S subunit of the 26S proteasome, interact with HIV-1 Vpr
14528300 Pull-down analysis shows that S2 and S5a, two components of the 19S subunit of the 26S proteasome, interact with HIV-1 Vpr
14527406 Pull-down analysis shows that S2 and S5a, two components of the 19S subunit of the 26S proteasome, interact with HIV-1 Vpr
12970355 Pull-down analysis shows that S2 and S5a, two components of the 19S subunit of the 26S proteasome, interact with HIV-1 Vpr
12920286 Pull-down analysis shows that S2 and S5a, two components of the 19S subunit of the 26S proteasome, interact with HIV-1 Vpr
12914693 Pull-down analysis shows that S2 and S5a, two components of the 19S subunit of the 26S proteasome, interact with HIV-1 Vpr
12859895 Pull-down analysis shows that S2 and S5a, two components of the 19S subunit of the 26S proteasome, interact with HIV-1 Vpr
12840737 Pull-down analysis shows that S2 and S5a, two components of the 19S subunit of the 26S proteasome, interact with HIV-1 Vpr
12830140 Pull-down analysis shows that S2 and S5a, two components of the 19S subunit of the 26S proteasome, interact with HIV-1 Vpr
12809610 Pull-down analysis shows that S2 and S5a, two components of the 19S subunit of the 26S proteasome, interact with HIV-1 Vpr
12808466 Pull-down analysis shows that S2 and S5a, two components of the 19S subunit of the 26S proteasome, interact with HIV-1 Vpr
12808465 Pull-down analysis shows that S2 and S5a, two components of the 19S subunit of the 26S proteasome, interact with HIV-1 Vpr
12750511 Pull-down analysis shows that S2 and S5a, two components of the 19S subunit of the 26S proteasome, interact with HIV-1 Vpr
12719574 Pull-down analysis shows that S2 and S5a, two components of the 19S subunit of the 26S proteasome, interact with HIV-1 Vpr
12419264 Pull-down analysis shows that S2 and S5a, two components of the 19S subunit of the 26S proteasome, interact with HIV-1 Vpr
12167863 Pull-down analysis shows that S2 and S5a, two components of the 19S subunit of the 26S proteasome, interact with HIV-1 Vpr
11827521 S5a component of the 19S complex interacts with different ubiquitin-like (ubl) modules
10893419 Pull-down analysis shows that S2 and S5a, two components of the 19S subunit of the 26S proteasome, interact with HIV-1 Vpr
9846577 Pull-down analysis shows that S2 and S5a, two components of the 19S subunit of the 26S proteasome, interact with HIV-1 Vpr
9811770 Pull-down analysis shows that S2 and S5a, two components of the 19S subunit of the 26S proteasome, interact with HIV-1 Vpr
9488668 Proteasome (prosome, macropain) 26S subunit, non-ATPase, 4 (also called subunit 5a) has two independent polyubiquitin binding sites whose sequences are highly conserved among higher eukaryotic orthologs.
9079628 Pull-down analysis shows that S2 and S5a, two components of the 19S subunit of the 26S proteasome, interact with HIV-1 Vpr

AA Sequence

MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGR      1 - 70
ILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDI     71 - 140
INFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGAMLGLGASDFEFGVDP    141 - 210
SADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATTGTEDSDDALLKMTISQQEFGRTGLPDLSS    211 - 280
MTEEEQIAYAMQMSLQGAEFGQAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNE    281 - 350
AIRNAMGSLASQATKDGKKDKKEEDKK                                               351 - 377
//

Text Mined References (105)

PMID Year Title
26903513 2016 Major Histocompatibility Complex (MHC) Class I Processing of the NY-ESO-1 Antigen Is Regulated by Rpn10 and Rpn13 Proteins and Immunoproteasomes following Non-lysine Ubiquitination.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25897558 2016 Interaction of Proteasomes and Complement C3, Assay of Antisecretory Factor in Blood.
25318673 2014 VWA domain of S5a restricts the ability to bind ubiquitin and Ubl to the 26S proteasome.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24829148 2014 S5a binds to death receptor-6 to induce THP-1 monocytes to differentiate through the activation of the NF-?B pathway.
24811749 2014 Autoubiquitination of the 26S proteasome on Rpn13 regulates breakdown of ubiquitin conjugates.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24250289 2013 Reduction of angiocidin contributes to decreased HepG2 cell proliferation.
24121268 2014 The degradation of p53 and its major E3 ligase Mdm2 is differentially dependent on the proteasomal ubiquitin receptor S5a.
24074603 2013 Interaction of HPV E6 oncoproteins with specific proteasomal subunits.
23966401 2013 Human cytomegalovirus UL76 elicits novel aggresome formation via interaction with S5a of the ubiquitin proteasome system.
23515276 2013 Impaired assembly and post-translational regulation of 26S proteasome in human end-stage heart failure.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22645313 2012 Identification and proteomic analysis of distinct UBE3A/E6AP protein complexes.
22434192 2012 FAT10 and NUB1L bind to the VWA domain of Rpn10 and Rpn1 to enable proteasome-mediated proteolysis.
21628408 2011 Pharmacogenomics of bortezomib test-dosing identifies hyperexpression of proteasome genes, especially PSMD4, as novel high-risk feature in myeloma treated with Total Therapy 3.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20417181 2010 Functional differences between two major ubiquitin receptors in the proteasome; S5a and hRpn13.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20059542 2010 Cross-species divergence of the major recognition pathways of ubiquitylated substrates for ubiquitin/26S proteasome-mediated proteolysis.
19931242 2010 The interaction of angiocidin with tissue transglutaminase.
19875440 2010 Differential interaction of the E3 ligase parkin with the proteasomal subunit S5a and the endocytic protein Eps15.
19798103 2009 Efficient protection and isolation of ubiquitylated proteins using tandem ubiquitin-binding entities.
19796170 2009 Accumulation of polyubiquitinated proteins by overexpression of RBCC protein interacting with protein kinase C2, a splice variant of ubiquitin ligase RBCC protein interacting with protein kinase C1.
19683493 2009 Structure of the s5a:k48-linked diubiquitin complex and its interactions with rpn13.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19519434 2009 The immunomodulatory role of angiocidin, a novel angiogenesis inhibitor.
19490896 2009 Assembly pathway of the Mammalian proteasome base subcomplex is mediated by multiple specific chaperones.
19387488 2009 S5a promotes protein degradation by blocking synthesis of nondegradable forked ubiquitin chains.
18922472 2008 Distinct modes of regulation of the Uch37 deubiquitinating enzyme in the proteasome and in the Ino80 chromatin-remodeling complex.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18632645 2008 The novel angiogenic inhibitor, angiocidin, induces differentiation of monocytes to macrophages.
18207252 2008 Angiocidin promotes pro-inflammatory cytokine production and antigen presentation in multiple sclerosis.
17949686 2007 The ubiquitin-interacting motif of 26S proteasome subunit S5a induces A549 lung cancer cell death.
17891176 2008 Interference of the dominant negative helix-loop-helix protein ID1 with the proteasomal subunit S5A causes centrosomal abnormalities.
17662948 2007 Regulation of Pax3 by proteasomal degradation of monoubiquitinated protein in skeletal muscle progenitors.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17459097 2007 Subunit S5a of the 26S proteasome is regulated by antiapoptotic signals.
17408689 2007 Defining how ubiquitin receptors hHR23a and S5a bind polyubiquitin.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17327906 2007 Proteasome activator enhances survival of Huntington's disease neuronal model cells.
17323924 2007 Mass spectrometric characterization of the affinity-purified human 26S proteasome complex.
17139257 2006 hRpn13/ADRM1/GP110 is a novel proteasome subunit that binds the deubiquitinating enzyme, UCH37.
17082820 2006 The UBL domain of PLIC-1 regulates aggresome formation.
16990800 2006 A novel proteasome interacting protein recruits the deubiquitinating enzyme UCH37 to 26S proteasomes.
16762342 2006 Integrin alpha2beta1 mediates the anti-angiogenic and anti-tumor activities of angiocidin, a novel tumor-associated protein.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15826667 2005 Structure of S5a bound to monoubiquitin provides a model for polyubiquitin recognition.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15340068 2004 Sequestosome 1/p62 is a polyubiquitin chain binding protein involved in ubiquitin proteasome degradation.
15280365 2004 The effects of the polyglutamine repeat protein ataxin-1 on the UbL-UBA protein A1Up.
15147878 2004 Ubiquilin interacts with ubiquitylated proteins and proteasome through its ubiquitin-associated and ubiquitin-like domains.
15029244 2004 Mammalian Cdh1/Fzr mediates its own degradation.
14759258 2004 An unappreciated role for RNA surveillance.
14614829 2003 The Vif protein of HIV triggers degradation of the human antiretroviral DNA deaminase APOBEC3G.
14585839 2004 Structure of the ubiquitin-interacting motif of S5a bound to the ubiquitin-like domain of HR23B.
14564014 2003 Induction of APOBEC3G ubiquitination and degradation by an HIV-1 Vif-Cul5-SCF complex.
14557625 2003 The human immunodeficiency virus type 1 Vif protein reduces intracellular expression and inhibits packaging of APOBEC3G (CEM15), a cellular inhibitor of virus infectivity.
14557549 2003 DNA-repair protein hHR23a alters its protein structure upon binding proteasomal subunit S5a.
14550573 2003 Human immunodeficiency virus-1 Tat protein interacts with distinct proteasomal alpha and beta subunits.
14528301 2003 HIV-1 Vif protein binds the editing enzyme APOBEC3G and induces its degradation.
14528300 2003 The antiretroviral enzyme APOBEC3G is degraded by the proteasome in response to HIV-1 Vif.
14527406 2003 HIV-1 Vif blocks the antiviral activity of APOBEC3G by impairing both its translation and intracellular stability.
12970355 2003 The enzymatic activity of CEM15/Apobec-3G is essential for the regulation of the infectivity of HIV-1 virion but not a sole determinant of its antiviral activity.
12970176 2003 Structural determinants for the binding of ubiquitin-like domains to the proteasome.
12920286 2003 Virology. Weapons of mutational destruction.
12914693 2003 Death by deamination: a novel host restriction system for HIV-1.
12859895 2003 Species-specific exclusion of APOBEC3G from HIV-1 virions by Vif.
12840737 2003 Good to CU.
12830140 2003 DNA deamination: not just a trigger for antibody diversification but also a mechanism for defense against retroviruses.
12809610 2003 DNA deamination mediates innate immunity to retroviral infection.
12808466 2003 Broad antiretroviral defence by human APOBEC3G through lethal editing of nascent reverse transcripts.
12808465 2003 The cytidine deaminase CEM15 induces hypermutation in newly synthesized HIV-1 DNA.
12791267 2003 Prophase destruction of Emi1 by the SCF(betaTrCP/Slimb) ubiquitin ligase activates the anaphase promoting complex to allow progression beyond prometaphase.
12750511 2003 Hypermutation of HIV-1 DNA in the absence of the Vif protein.
12719574 2003 Comprehensive investigation of the molecular defect in vif-deficient human immunodeficiency virus type 1 virions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12419264 2002 The RTP site shared by the HIV-1 Tat protein and the 11S regulator subunit alpha is crucial for their effects on proteasome function including antigen processing.
12167863 2002 Isolation of a human gene that inhibits HIV-1 infection and is suppressed by the viral Vif protein.
11827521 2002 Structural studies of the interaction between ubiquitin family proteins and proteasome subunit S5a.
11585840 2001 Targeting of NEDD8 and its conjugates for proteasomal degradation by NUB1.
11285280 2001 Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint.
11146632 2001 The co-chaperone CHIP regulates protein triage decisions mediated by heat-shock proteins.
10921894 2000 Developmentally regulated, alternative splicing of the Rpn10 gene generates multiple forms of 26S proteasomes.
10893419 2000 Degradation of HIV-1 integrase by the N-end rule pathway.
10799514 2000 Hybrid proteasomes. Induction by interferon-gamma and contribution to ATP-dependent proteolysis.
10505793 1999 Molecular cloning and expression of rat antisecretory factor and its intracellular localization.
10488153 1999 Interaction of hHR23 with S5a. The ubiquitin-like domain of hHR23 mediates interaction with S5a subunit of 26 S proteasome.
9846577 1998 Evidence for a newly discovered cellular anti-HIV-1 phenotype.
9811770 1998 An endogenous inhibitor of human immunodeficiency virus in human lymphocytes is overcome by the viral Vif protein.
9488668 1998 Characterization of two polyubiquitin binding sites in the 26 S protease subunit 5a.
9235903 1997 Novel regulation of the helix-loop-helix protein Id1 by S5a, a subunit of the 26 S proteasome.
9079628 1997 HIV-1 tat inhibits the 20 S proteasome and its 11 S regulator-mediated activation.
8811196 1996 Structure and functions of the 20S and 26S proteasomes.
8641424 1996 Molecular cloning and expression of a multiubiquitin chain binding subunit of the human 26S protease.
8570649 1996 Surface hydrophobic residues of multiubiquitin chains essential for proteolytic targeting.
7657640 1995 Molecular cloning and expression of a pituitary gland protein modulating intestinal fluid secretion.
3524692 1986 Purification and characterization of the antisecretory factor: a protein in the central nervous system and in the gut which inhibits intestinal hypersecretion induced by cholera toxin.