Property Summary

NCBI Gene PubMed Count 52
PubMed Score 15.91
PubTator Score 9.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
HIV Infections 102 0.0 0.0
Disease Target Count P-value
lung adenocarcinoma 2716 2.5e-08
breast carcinoma 1638 2.6e-03
dermatomyositis 966 4.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma 2.000 2.6e-03
dermatomyositis -1.200 4.2e-03
lung adenocarcinoma 1.042 2.5e-08

 GO Function (1)

Protein-protein Interaction (10)

PDB (15)

Gene RIF (32)

AA Sequence

MKQEGSARRRGADKAKPPPGGGEQEPPPPPAPQDVEMKEEAATGGGSTGEADGKTAAAAAEHSQRELDTV      1 - 70
TLEDIKEHVKQLEKAVSGKEPRFVLRALRMLPSTSRRLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMD     71 - 140
TEADLQFRPRTGKAASTPLLPEVEAYLQLLVVIFMMNSKRYKEAQKISDDLMQKISTQNRRALDLVAAKC    141 - 210
YYYHARVYEFLDKLDVVRSFLHARLRTATLRHDADGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQA    211 - 280
NNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQ    281 - 350
PSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLA    351 - 420
DIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMS    421 - 490
VKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSFP                              491 - 534
//

Text Mined References (62)

PMID Year Title