| Tbio | 26S proteasome non-ATPase regulatory subunit 3 |
Acts as a regulatory subunit of the 26 proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.
The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the proteasome subunit S3 family that functions as one of the non-ATPase subunits of the 19S regulator lid. Single nucleotide polymorphisms in this gene are associated with neutrophil count. [provided by RefSeq, Jul 2012]
The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the proteasome subunit S3 family that functions as one of the non-ATPase subunits of the 19S regulator lid. Single nucleotide polymorphisms in this gene are associated with neutrophil count. [provided by RefSeq, Jul 2012]
Comments
| Disease | Target Count |
|---|---|
| HIV Infections | 99 |
| Disease | Target Count | P-value |
|---|---|---|
| lung adenocarcinoma | 2714 | 2.5e-08 |
| breast carcinoma | 1614 | 2.6e-03 |
| dermatomyositis | 966 | 4.2e-03 |
| Disease | log2 FC | p |
|---|---|---|
| breast carcinoma | 2.000 | 2.6e-03 |
| lung adenocarcinoma | 1.042 | 2.5e-08 |
| dermatomyositis | -1.200 | 4.2e-03 |
| PMID | Text | |
|---|---|---|
| 25515861 | A strong association between genetic variant rs2305482 in PSMD3 on chromosome 17 and IFN-induced neutropenia. | |
| 23303871 | Our study suggests that PSMD3 variants are associated with insulin resistance in populations of different ancestries and that these relationships may also be modified by dietary factors. | |
| 22788528 | HNF1A gene was associated with C-reactive protein, and the region including PSMD3 and CSF3 genes was associated with white blood cell count. | |
| 22037903 | Study identified significantly white blood cell count (WBC) level associated SNPs of three separate genes GSDMA, MED24, and PSMD3 in European continent (EA) subjects. | |
| 20172861 | The significant contribution of PSMD3-CSF3 and PLCB4 loci to the regulation of neutrophil count, is demonstrated. | |
| 20172861 | Observational study and genome-wide association study of gene-disease association. (HuGE Navigator) | |
| 14614829 | HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication | |
| 14564014 | HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication | |
| 14557625 | HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication | |
| 14550573 | HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication | |
| 14528301 | HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication | |
| 14528300 | HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication | |
| 14527406 | HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication | |
| 12970355 | HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication | |
| 12920286 | HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication | |
| 12914693 | HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication | |
| 12859895 | HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication | |
| 12840737 | HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication | |
| 12830140 | HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication | |
| 12809610 | HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication | |
| 12808466 | HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication | |
| 12808465 | HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication | |
| 12750511 | HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication | |
| 12719574 | HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication | |
| 12419264 | HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication | |
| 12167863 | HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication | |
| 10893419 | HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication | |
| 9846577 | HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication | |
| 9811770 | HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication | |
| 9079628 | HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication |
MKQEGSARRRGADKAKPPPGGGEQEPPPPPAPQDVEMKEEAATGGGSTGEADGKTAAAAAEHSQRELDTV 1 - 70 TLEDIKEHVKQLEKAVSGKEPRFVLRALRMLPSTSRRLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMD 71 - 140 TEADLQFRPRTGKAASTPLLPEVEAYLQLLVVIFMMNSKRYKEAQKISDDLMQKISTQNRRALDLVAAKC 141 - 210 YYYHARVYEFLDKLDVVRSFLHARLRTATLRHDADGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQA 211 - 280 NNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQ 281 - 350 PSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLA 351 - 420 DIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMS 421 - 490 VKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSFP 491 - 534 //
| PMID | Year | Title | |
|---|---|---|---|
| 25814554 | 2015 | Phospho-tyrosine dependent protein-protein interaction network. | |
| 25515861 | 2015 | Genome-wide association study identifies a PSMD3 variant associated with neutropenia in interferon-based therapy for chronic hepatitis C. | |
| 25416956 | 2014 | A proteome-scale map of the human interactome network. | |
| 25114211 | 2014 | Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli. | |
| 24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. | |
| 23303871 | 2013 | Genetic variants at PSMD3 interact with dietary fat and carbohydrate to modulate insulin resistance. | |
| 23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. | |
| 22814378 | 2012 | N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. | |
| 22788528 | 2013 | Genetic associations with C-reactive protein level and white blood cell count in the KARE study. | |
| 22037903 | 2012 | Genetic variants associated with the white blood cell count in 13,923 subjects in the eMERGE Network. | |
| 21738480 | 2011 | Multiple loci are associated with white blood cell phenotypes. | |
| 21738478 | 2011 | Identification of nine novel loci associated with white blood cell subtypes in a Japanese population. | |
| 21630459 | 2011 | Proteomic characterization of the human sperm nucleus. | |
| 21269460 | 2011 | Initial characterization of the human central proteome. | |
| 20172861 | 2010 | Common variations in PSMD3-CSF3 and PLCB4 are associated with neutrophil count. | |
| 20139978 | 2010 | Genome-wide association study of hematological and biochemical traits in a Japanese population. | |
| 19946888 | 2010 | Defining the membrane proteome of NK cells. | |
| 19056867 | 2009 | Large-scale proteomics and phosphoproteomics of urinary exosomes. | |
| 17353931 | 2007 | Large-scale mapping of human protein-protein interactions by mass spectrometry. | |
| 17323924 | 2007 | Mass spectrometric characterization of the affinity-purified human 26S proteasome complex. | |
| 16625196 | 2006 | DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 15147878 | 2004 | Ubiquilin interacts with ubiquitylated proteins and proteasome through its ubiquitin-associated and ubiquitin-like domains. | |
| 15029244 | 2004 | Mammalian Cdh1/Fzr mediates its own degradation. | |
| 14743216 | 2004 | A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway. | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 14614829 | 2003 | The Vif protein of HIV triggers degradation of the human antiretroviral DNA deaminase APOBEC3G. | |
| 14564014 | 2003 | Induction of APOBEC3G ubiquitination and degradation by an HIV-1 Vif-Cul5-SCF complex. | |
| 14557625 | 2003 | The human immunodeficiency virus type 1 Vif protein reduces intracellular expression and inhibits packaging of APOBEC3G (CEM15), a cellular inhibitor of virus infectivity. | |
| 14550573 | 2003 | Human immunodeficiency virus-1 Tat protein interacts with distinct proteasomal alpha and beta subunits. | |
| 14528301 | 2003 | HIV-1 Vif protein binds the editing enzyme APOBEC3G and induces its degradation. | |
| 14528300 | 2003 | The antiretroviral enzyme APOBEC3G is degraded by the proteasome in response to HIV-1 Vif. | |
| 14527406 | 2003 | HIV-1 Vif blocks the antiviral activity of APOBEC3G by impairing both its translation and intracellular stability. | |
| 12970355 | 2003 | The enzymatic activity of CEM15/Apobec-3G is essential for the regulation of the infectivity of HIV-1 virion but not a sole determinant of its antiviral activity. | |
| 12920286 | 2003 | Virology. Weapons of mutational destruction. | |
| 12914693 | 2003 | Death by deamination: a novel host restriction system for HIV-1. | |
| 12859895 | 2003 | Species-specific exclusion of APOBEC3G from HIV-1 virions by Vif. | |
| 12840737 | 2003 | Good to CU. | |
| 12830140 | 2003 | DNA deamination: not just a trigger for antibody diversification but also a mechanism for defense against retroviruses. | |
| 12809610 | 2003 | DNA deamination mediates innate immunity to retroviral infection. | |
| 12808466 | 2003 | Broad antiretroviral defence by human APOBEC3G through lethal editing of nascent reverse transcripts. | |
| 12808465 | 2003 | The cytidine deaminase CEM15 induces hypermutation in newly synthesized HIV-1 DNA. | |
| 12791267 | 2003 | Prophase destruction of Emi1 by the SCF(betaTrCP/Slimb) ubiquitin ligase activates the anaphase promoting complex to allow progression beyond prometaphase. | |
| 12750511 | 2003 | Hypermutation of HIV-1 DNA in the absence of the Vif protein. | |
| 12719574 | 2003 | Comprehensive investigation of the molecular defect in vif-deficient human immunodeficiency virus type 1 virions. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 12419264 | 2002 | The RTP site shared by the HIV-1 Tat protein and the 11S regulator subunit alpha is crucial for their effects on proteasome function including antigen processing. | |
| 12167863 | 2002 | Isolation of a human gene that inhibits HIV-1 infection and is suppressed by the viral Vif protein. | |
| 11285280 | 2001 | Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint. | |
| 10893419 | 2000 | Degradation of HIV-1 integrase by the N-end rule pathway. | |
| 9846577 | 1998 | Evidence for a newly discovered cellular anti-HIV-1 phenotype. | |
| 9811770 | 1998 | An endogenous inhibitor of human immunodeficiency virus in human lymphocytes is overcome by the viral Vif protein. | |
| 9079628 | 1997 | HIV-1 tat inhibits the 20 S proteasome and its 11 S regulator-mediated activation. | |
| 9017604 | 1997 | Yeast counterparts of subunits S5a and p58 (S3) of the human 26S proteasome are encoded by two multicopy suppressors of nin1-1. | |
| 8811196 | 1996 | Structure and functions of the 20S and 26S proteasomes. |
