Property Summary

NCBI Gene PubMed Count 66
PubMed Score 35.79
PubTator Score 10.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
non-small cell lung cancer 2798 2.9e-19
ovarian cancer 8491 8.2e-06
psoriasis 6685 1.2e-04
inflammatory breast cancer 404 3.8e-03
lung cancer 4473 8.2e-03

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.300 1.2e-04
non-small cell lung cancer 1.284 2.9e-19
lung cancer 1.300 8.2e-03
inflammatory breast cancer 1.300 3.8e-03
ovarian cancer 2.200 8.2e-06

 GO Function (1)

Gene RIF (35)

PMID Text
23667555 the high-resolution solution structure of the UBL domain of human UBLCP1 and its interaction with Rpn1
23166591 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21465578 Results suggest that PSMD2 may be a good molecular target candidate.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20614012 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
19881955 the 26S proteasome may provide a general predictive biomarker for radiotherapy outcome.
19815544 These data suggest that p97 recruits proteasomes to polytopic ER proteins, such as Insig-1, even before they are extracted from membranes.
19638347 Data show that data provide a novel mechanism whereby CaMKII may regulate the proteasome in neurons to facilitate remodeling of synaptic connections through protein degradation.
19626040 Observational study of gene-disease association. (HuGE Navigator)
18337449 U87 glioblastoma cells transduced to express the epidermal growth factor receptor vIII (EGFRvIII) mutant do not respond toirrradiation with 26s proteasome inhibition.
14614829 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
14564014 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
14557625 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
14550573 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
14528301 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
14528300 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
14527406 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12970355 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12920286 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12914693 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12859895 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12840737 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12830140 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12809610 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12808466 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12808465 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12750511 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12719574 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12419264 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12167863 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
10893419 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
9846577 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
9811770 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
9079628 Tandem affinity purification and mass spectrometry analysis identify 26S proteasome non-ATPase regulatory subunit 2 (PSMD2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells

AA Sequence

MEEGGRDKAPVQPQQSPAAAPGGTDEKPSGKERRDAGDKDKEQELSEEDKQLQDELEMLVERLGEKDTSL      1 - 70
YRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMAPGENKRFAADIISVLAMTMSGERECL     71 - 140
KYRLVGSQEELASWGHEYVRHLAGEVAKEWQELDDAEKVQREPLLTLVKEIVPYNMAHNAEHEACDLLME    141 - 210
IEQVDMLEKDIDENAYAKVCLYLTSCVNYVPEPENSALLRCALGVFRKFSRFPEALRLALMLNDMELVED    211 - 280
IFTSCKDVVVQKQMAFMLGRHGVFLELSEDVEEYEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYK    281 - 350
THLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDDGNKWLYKNKDHGMLSAAASLGMILLW    351 - 420
DVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRLGSIFGLGLAYA    421 - 490
GSNREDVLTLLLPVMGDSKSSMEVAGVTALACGMIAVGSCNGDVTSTILQTIMEKSETELKDTYARWLPL    491 - 560
GLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAYAGSGNVLKVQQLLHICSEHFDSKEKEEDKD    561 - 630
KKEKKDKDKKEAPADMGAHQGVAVLGIALIAMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVS    631 - 700
NPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTH    701 - 770
LGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPL    771 - 840
PVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPILEGFVILRKNPNYDL      841 - 908
//

Text Mined References (78)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23667555 2013 Solution structure and Rpn1 interaction of the UBL domain of human RNA polymerase II C-terminal domain phosphatase.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22901813 2012 Cancer vulnerabilities unveiled by genomic loss.
21465578 2011 Proteasomal non-catalytic subunit PSMD2 as a potential therapeutic target in association with various clinicopathologic features in lung adenocarcinomas.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19881955 2009 Proteomic identification of putative biomarkers of radiotherapy resistance: a possible role for the 26S proteasome?
19815544 2009 Regulated endoplasmic reticulum-associated degradation of a polytopic protein: p97 recruits proteasomes to Insig-1 before extraction from membranes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19638347 2009 Regulation of the proteasome by neuronal activity and calcium/calmodulin-dependent protein kinase II.
19626040 2009 Follow-up examination of linkage and association to chromosome 1q43 in multiple sclerosis.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19490896 2009 Assembly pathway of the Mammalian proteasome base subcomplex is mediated by multiple specific chaperones.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19060904 2009 An empirical framework for binary interactome mapping.
18922472 2008 Distinct modes of regulation of the Uch37 deubiquitinating enzyme in the proteasome and in the Ino80 chromatin-remodeling complex.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18457437 2008 Identification of intracellular proteins associated with the EBV-encoded nuclear antigen 5 using an efficient TAP procedure and FT-ICR mass spectrometry.
18337449 2008 Epidermal growth factor receptor vIII expression in U87 glioblastoma cells alters their proteasome composition, function, and response to irradiation.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17323924 2007 Mass spectrometric characterization of the affinity-purified human 26S proteasome complex.
17220478 2007 Proteomics analysis of the interactome of N-myc downstream regulated gene 1 and its interactions with the androgen response program in prostate cancer cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16990800 2006 A novel proteasome interacting protein recruits the deubiquitinating enzyme UCH37 to 26S proteasomes.
16763564 2006 Roles for APIS and the 20S proteasome in adenovirus E1A-dependent transcription.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15029244 2004 Mammalian Cdh1/Fzr mediates its own degradation.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14614829 2003 The Vif protein of HIV triggers degradation of the human antiretroviral DNA deaminase APOBEC3G.
14564014 2003 Induction of APOBEC3G ubiquitination and degradation by an HIV-1 Vif-Cul5-SCF complex.
14557625 2003 The human immunodeficiency virus type 1 Vif protein reduces intracellular expression and inhibits packaging of APOBEC3G (CEM15), a cellular inhibitor of virus infectivity.
14550573 2003 Human immunodeficiency virus-1 Tat protein interacts with distinct proteasomal alpha and beta subunits.
14528301 2003 HIV-1 Vif protein binds the editing enzyme APOBEC3G and induces its degradation.
14528300 2003 The antiretroviral enzyme APOBEC3G is degraded by the proteasome in response to HIV-1 Vif.
14527406 2003 HIV-1 Vif blocks the antiviral activity of APOBEC3G by impairing both its translation and intracellular stability.
12970355 2003 The enzymatic activity of CEM15/Apobec-3G is essential for the regulation of the infectivity of HIV-1 virion but not a sole determinant of its antiviral activity.
12920286 2003 Virology. Weapons of mutational destruction.
12914693 2003 Death by deamination: a novel host restriction system for HIV-1.
12859895 2003 Species-specific exclusion of APOBEC3G from HIV-1 virions by Vif.
12840737 2003 Good to CU.
12830140 2003 DNA deamination: not just a trigger for antibody diversification but also a mechanism for defense against retroviruses.
12809610 2003 DNA deamination mediates innate immunity to retroviral infection.
12808466 2003 Broad antiretroviral defence by human APOBEC3G through lethal editing of nascent reverse transcripts.
12808465 2003 The cytidine deaminase CEM15 induces hypermutation in newly synthesized HIV-1 DNA.
12791267 2003 Prophase destruction of Emi1 by the SCF(betaTrCP/Slimb) ubiquitin ligase activates the anaphase promoting complex to allow progression beyond prometaphase.
12750511 2003 Hypermutation of HIV-1 DNA in the absence of the Vif protein.
12719574 2003 Comprehensive investigation of the molecular defect in vif-deficient human immunodeficiency virus type 1 virions.
12692129 2003 Proteolytic targeting of transcriptional regulator TIP120B by a HECT domain E3 ligase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12419264 2002 The RTP site shared by the HIV-1 Tat protein and the 11S regulator subunit alpha is crucial for their effects on proteasome function including antigen processing.
12167863 2002 Isolation of a human gene that inhibits HIV-1 infection and is suppressed by the viral Vif protein.
11285280 2001 Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint.
11278995 2001 A HECT domain E3 enzyme assembles novel polyubiquitin chains.
10893419 2000 Degradation of HIV-1 integrase by the N-end rule pathway.
10625621 2000 Mapping subunit contacts in the regulatory complex of the 26 S proteasome. S2 and S5b form a tetramer with ATPase subunits S4 and S7.
9846577 1998 Evidence for a newly discovered cellular anti-HIV-1 phenotype.
9811770 1998 An endogenous inhibitor of human immunodeficiency virus in human lymphocytes is overcome by the viral Vif protein.
9126987 1997 Two-hybrid cloning of a gene encoding TNF receptor-associated protein 2, a protein that interacts with the intracellular domain of the type 1 TNF receptor: identity with subunit 2 of the 26S protease.
9079628 1997 HIV-1 tat inhibits the 20 S proteasome and its 11 S regulator-mediated activation.
8811196 1996 Structure and functions of the 20S and 26S proteasomes.
8774743 1996 cDNA cloning and functional analysis of the p97 subunit of the 26S proteasome, a polypeptide identical to the type-1 tumor-necrosis-factor-receptor-associated protein-2/55.11.
7639698 1995 Association of a RING finger protein with the cytoplasmic domain of the human type-2 tumour necrosis factor receptor.
7601280 1995 A protein related to a proteasomal subunit binds to the intracellular domain of the p55 TNF receptor upstream to its 'death domain'.