Property Summary

NCBI Gene PubMed Count 49
PubMed Score 13.28
PubTator Score 8.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.100 1.1e-04
atypical teratoid / rhabdoid tumor -1.200 1.0e-04
Breast cancer -1.400 2.0e-10
ependymoma -1.100 3.0e-02
glioblastoma -1.200 2.4e-05
lung adenocarcinoma 1.022 4.9e-06
lung cancer 1.300 1.4e-03
malignant mesothelioma 1.800 1.4e-07
Multiple myeloma 1.011 4.1e-03
osteosarcoma -1.475 1.2e-05
ovarian cancer -1.100 2.8e-09
Pick disease -1.200 3.5e-03
subependymal giant cell astrocytoma -1.128 7.7e-03
tuberculosis and treatment for 3 months 1.100 1.6e-04

PDB (15)

Gene RIF (30)

AA Sequence

MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLL      1 - 70
KYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDT     71 - 140
KRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATL    141 - 210
DMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYA    211 - 280
GRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHI    281 - 350
SSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKK    351 - 420
LT                                                                        421 - 422
//

Text Mined References (60)

PMID Year Title