Property Summary

NCBI Gene PubMed Count 49
PubMed Score 11.30
PubTator Score 8.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.011 4.1e-03
malignant mesothelioma 1.800 1.4e-07
ependymoma -1.100 3.0e-02
osteosarcoma -1.475 1.2e-05
atypical teratoid / rhabdoid tumor -1.200 1.0e-04
glioblastoma -1.200 2.4e-05
tuberculosis and treatment for 6 months 1.700 2.4e-05
lung cancer 1.300 1.4e-03
pediatric high grade glioma -1.100 8.1e-06
subependymal giant cell astrocytoma -1.128 7.7e-03
lung adenocarcinoma 1.022 4.9e-06
Pick disease -1.200 3.5e-03
Breast cancer -1.400 2.0e-10
ovarian cancer 1.700 1.2e-05

Protein-protein Interaction (8)

Gene RIF (29)

PMID Text
26669444 Data show that activated PKA phosphorylates the 19S subunit, Rpn6/PSMD11 (regulatory particle non-ATPase 6/proteasome subunit D11) at Ser14.
22972301 human embryonic stem cells (hESCs) exhibit high proteasome activity that is correlated with increased levels of the 19S proteasome subunit PSMD11 (known as RPN-6 in Caenorhabditis elegans) and a corresponding increased assembly of the 26S/30S proteasome
22190034 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
19616115 AMP-activated protein kinase is able to interact physically with this subunit and modify its phosphorylation status.
14614829 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14564014 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14557625 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14550573 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14528301 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14528300 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14527406 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12970355 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12920286 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12914693 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12859895 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12840737 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12830140 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12809610 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12808466 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12808465 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12750511 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12719574 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12419264 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12185077 interaction with ubiquitinated NF-kappaB2/p100
12167863 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
10893419 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
9846577 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
9811770 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
9079628 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLL      1 - 70
KYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDT     71 - 140
KRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATL    141 - 210
DMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYA    211 - 280
GRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHI    281 - 350
SSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKK    351 - 420
LT                                                                        421 - 422
//

Text Mined References (57)

PMID Year Title
26669444 2015 cAMP-induced phosphorylation of 26S proteasomes on Rpn6/PSMD11 enhances their activity and the degradation of misfolded proteins.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22972301 2012 Increased proteasome activity in human embryonic stem cells is regulated by PSMD11.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19616115 2009 Two-hybrid analysis identifies PSMD11, a non-ATPase subunit of the proteasome, as a novel interaction partner of AMP-activated protein kinase.
19490896 2009 Assembly pathway of the Mammalian proteasome base subcomplex is mediated by multiple specific chaperones.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17323924 2007 Mass spectrometric characterization of the affinity-purified human 26S proteasome complex.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15029244 2004 Mammalian Cdh1/Fzr mediates its own degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14614829 2003 The Vif protein of HIV triggers degradation of the human antiretroviral DNA deaminase APOBEC3G.
14564014 2003 Induction of APOBEC3G ubiquitination and degradation by an HIV-1 Vif-Cul5-SCF complex.
14557625 2003 The human immunodeficiency virus type 1 Vif protein reduces intracellular expression and inhibits packaging of APOBEC3G (CEM15), a cellular inhibitor of virus infectivity.
14550573 2003 Human immunodeficiency virus-1 Tat protein interacts with distinct proteasomal alpha and beta subunits.
14528301 2003 HIV-1 Vif protein binds the editing enzyme APOBEC3G and induces its degradation.
14528300 2003 The antiretroviral enzyme APOBEC3G is degraded by the proteasome in response to HIV-1 Vif.
14527406 2003 HIV-1 Vif blocks the antiviral activity of APOBEC3G by impairing both its translation and intracellular stability.
12970355 2003 The enzymatic activity of CEM15/Apobec-3G is essential for the regulation of the infectivity of HIV-1 virion but not a sole determinant of its antiviral activity.
12920286 2003 Virology. Weapons of mutational destruction.
12914693 2003 Death by deamination: a novel host restriction system for HIV-1.
12859895 2003 Species-specific exclusion of APOBEC3G from HIV-1 virions by Vif.
12840737 2003 Good to CU.
12830140 2003 DNA deamination: not just a trigger for antibody diversification but also a mechanism for defense against retroviruses.
12809610 2003 DNA deamination mediates innate immunity to retroviral infection.
12808466 2003 Broad antiretroviral defence by human APOBEC3G through lethal editing of nascent reverse transcripts.
12808465 2003 The cytidine deaminase CEM15 induces hypermutation in newly synthesized HIV-1 DNA.
12791267 2003 Prophase destruction of Emi1 by the SCF(betaTrCP/Slimb) ubiquitin ligase activates the anaphase promoting complex to allow progression beyond prometaphase.
12750511 2003 Hypermutation of HIV-1 DNA in the absence of the Vif protein.
12719574 2003 Comprehensive investigation of the molecular defect in vif-deficient human immunodeficiency virus type 1 virions.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12419264 2002 The RTP site shared by the HIV-1 Tat protein and the 11S regulator subunit alpha is crucial for their effects on proteasome function including antigen processing.
12185077 2002 S9, a 19 S proteasome subunit interacting with ubiquitinated NF-kappaB2/p100.
12167863 2002 Isolation of a human gene that inhibits HIV-1 infection and is suppressed by the viral Vif protein.
11285280 2001 Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint.
10893419 2000 Degradation of HIV-1 integrase by the N-end rule pathway.
9846577 1998 Evidence for a newly discovered cellular anti-HIV-1 phenotype.
9811770 1998 An endogenous inhibitor of human immunodeficiency virus in human lymphocytes is overcome by the viral Vif protein.
9426256 1997 cDNA cloning and functional analysis of p44.5 and p55, two regulatory subunits of the 26S proteasome.
9119060 1997 Molecular cloning and expression of subunit 9 of the 26S proteasome.
9079628 1997 HIV-1 tat inhibits the 20 S proteasome and its 11 S regulator-mediated activation.
8811196 1996 Structure and functions of the 20S and 26S proteasomes.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
1317798 1992 Demonstration that a human 26S proteolytic complex consists of a proteasome and multiple associated protein components and hydrolyzes ATP and ubiquitin-ligated proteins by closely linked mechanisms.