Property Summary

NCBI Gene PubMed Count 65
PubMed Score 33.40
PubTator Score 24.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 9.0e-05
glioblastoma 5792 1.2e-03
osteosarcoma 7950 1.3e-03
diabetes mellitus 1728 1.6e-03
astrocytoma 1146 1.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytoma 1.200 1.9e-03
diabetes mellitus -1.200 1.6e-03
glioblastoma 1.300 1.2e-03
osteosarcoma -1.156 1.3e-03
ovarian cancer 1.300 9.0e-05

PDB (23)

Gene RIF (39)

AA Sequence

MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKK      1 - 70
EFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALV     71 - 140
DVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGC    141 - 210
GKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTG    211 - 280
ADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITS    281 - 350
KMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK      351 - 418
//

Text Mined References (80)

PMID Year Title