Property Summary

NCBI Gene PubMed Count 64
PubMed Score 31.80
PubTator Score 24.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 9.0e-05
glioblastoma 5572 1.2e-03
osteosarcoma 7933 1.3e-03
diabetes mellitus 1663 1.6e-03
astrocytoma 1493 1.9e-03

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.156 1.3e-03
astrocytoma 1.200 1.9e-03
glioblastoma 1.300 1.2e-03
diabetes mellitus -1.200 1.6e-03
ovarian cancer 1.300 9.0e-05

Gene RIF (39)

PMID Text
26655835 Site-specific Rpt3 phosphorylation by DYRK2 controls cell proliferation and tumorigenesis in breast neoplasms.
22944692 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
22370480 Saquinavir-NO inhibits activation of S6 protein in androgen-dependent prostate cancer cells.
21979464 The proposed TRAP1 network has an impact in vivo, as it is conserved in human colorectal cancers, is controlled by ER-localized TRAP1 interacting with TBP7 and provides a novel model of the ER-mitochondria crosstalk.
20937828 C terminus of Rpt3, an ATPase subunit of PA700 (19 S) regulatory complex, is essential for 26 S proteasome assembly but not for activation
18854154 Knockdown of proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18446261 An insertion/deletion variant in intron 5 of the S6 ATPase gene was more frequent in German Parkinson's disease patients compared to controls
17327361 a novel specific interaction of synphilin-1 with the regulatory proteasomal protein S6 ATPase (tbp7) in aggresome-like intracytoplasmic inclusions
14614829 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
14564014 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
14557625 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
14550573 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
14528301 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
14528300 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
14527406 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
12970355 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
12920286 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
12914693 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
12859895 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
12840737 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
12830140 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
12809610 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
12808466 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
12808465 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
12750511 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
12719574 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
12419264 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
12167863 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
11779854 interacts with gankyrin through C-terminal 78 amino acids
11463857 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
10893419 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
9846577 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
9811770 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
9714759 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
9079628 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
8500623 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
8419915 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
8323548 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease
2194290 Positional proteomics analysis identifies the cleavage of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4) at amino acid residues 7-8 by the HIV-1 protease

AA Sequence

MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKK      1 - 70
EFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALV     71 - 140
DVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGC    141 - 210
GKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTG    211 - 280
ADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITS    281 - 350
KMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK      351 - 418
//

Text Mined References (77)

PMID Year Title
26655835 2016 Site-specific proteasome phosphorylation controls cell proliferation and tumorigenesis.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22901813 2012 Cancer vulnerabilities unveiled by genomic loss.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22651796 2012 A molecular signature in blood identifies early Parkinson's disease.
22370480 2012 Saquinavir-NO-targeted S6 protein mediates sensitivity of androgen-dependent prostate cancer cells to TRAIL.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22078707 2011 TRIM5? associates with proteasomal subunits in cells while in complex with HIV-1 virions.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21979464 2012 TRAP1 and the proteasome regulatory particle TBP7/Rpt3 interact in the endoplasmic reticulum and control cellular ubiquitination of specific mitochondrial proteins.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
20937828 2010 The C terminus of Rpt3, an ATPase subunit of PA700 (19 S) regulatory complex, is essential for 26 S proteasome assembly but not for activation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19490896 2009 Assembly pathway of the Mammalian proteasome base subcomplex is mediated by multiple specific chaperones.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18446261 2008 A comprehensive genetic study of the proteasomal subunit S6 ATPase in German Parkinson's disease patients.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17327361 2007 The proteasomal subunit S6 ATPase is a novel synphilin-1 interacting protein--implications for Parkinson's disease.
17323924 2007 Mass spectrometric characterization of the affinity-purified human 26S proteasome complex.
17292836 2007 Structure of the oncoprotein gankyrin in complex with S6 ATPase of the 26S proteasome.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15831487 2005 Proteasomal ATPase-associated factor 1 negatively regulates proteasome activity by interacting with proteasomal ATPases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
15029244 2004 Mammalian Cdh1/Fzr mediates its own degradation.
14614829 2003 The Vif protein of HIV triggers degradation of the human antiretroviral DNA deaminase APOBEC3G.
14564014 2003 Induction of APOBEC3G ubiquitination and degradation by an HIV-1 Vif-Cul5-SCF complex.
14557625 2003 The human immunodeficiency virus type 1 Vif protein reduces intracellular expression and inhibits packaging of APOBEC3G (CEM15), a cellular inhibitor of virus infectivity.
14550573 2003 Human immunodeficiency virus-1 Tat protein interacts with distinct proteasomal alpha and beta subunits.
14528301 2003 HIV-1 Vif protein binds the editing enzyme APOBEC3G and induces its degradation.
14528300 2003 The antiretroviral enzyme APOBEC3G is degraded by the proteasome in response to HIV-1 Vif.
14527406 2003 HIV-1 Vif blocks the antiviral activity of APOBEC3G by impairing both its translation and intracellular stability.
12970355 2003 The enzymatic activity of CEM15/Apobec-3G is essential for the regulation of the infectivity of HIV-1 virion but not a sole determinant of its antiviral activity.
12920286 2003 Virology. Weapons of mutational destruction.
12914693 2003 Death by deamination: a novel host restriction system for HIV-1.
12859895 2003 Species-specific exclusion of APOBEC3G from HIV-1 virions by Vif.
12840737 2003 Good to CU.
12830140 2003 DNA deamination: not just a trigger for antibody diversification but also a mechanism for defense against retroviruses.
12809610 2003 DNA deamination mediates innate immunity to retroviral infection.
12808466 2003 Broad antiretroviral defence by human APOBEC3G through lethal editing of nascent reverse transcripts.
12808465 2003 The cytidine deaminase CEM15 induces hypermutation in newly synthesized HIV-1 DNA.
12791267 2003 Prophase destruction of Emi1 by the SCF(betaTrCP/Slimb) ubiquitin ligase activates the anaphase promoting complex to allow progression beyond prometaphase.
12750511 2003 Hypermutation of HIV-1 DNA in the absence of the Vif protein.
12719574 2003 Comprehensive investigation of the molecular defect in vif-deficient human immunodeficiency virus type 1 virions.
12525503 2003 MAGE-A4 interacts with the liver oncoprotein gankyrin and suppresses its tumorigenic activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12419264 2002 The RTP site shared by the HIV-1 Tat protein and the 11S regulator subunit alpha is crucial for their effects on proteasome function including antigen processing.
12167863 2002 Isolation of a human gene that inhibits HIV-1 infection and is suppressed by the viral Vif protein.
11779854 2002 Gankyrin is an ankyrin-repeat oncoprotein that interacts with CDK4 kinase and the S6 ATPase of the 26 S proteasome.
11463857 2001 Human immunodeficiency virus type 1 Tat binding protein-1 is a transcriptional coactivator specific for TR.
11361004 2001 Quaternary structure of the ATPase complex of human 26S proteasomes determined by chemical cross-linking.
11285280 2001 Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10893419 2000 Degradation of HIV-1 integrase by the N-end rule pathway.
9846577 1998 Evidence for a newly discovered cellular anti-HIV-1 phenotype.
9811770 1998 An endogenous inhibitor of human immunodeficiency virus in human lymphocytes is overcome by the viral Vif protein.
9714759 1998 Cloning and heterogeneous in vivo expression of Tat binding protein-1 (TBP-1) in the mouse.
9473509 1998 Chromosomal localization and immunological analysis of a family of human 26S proteasomal ATPases.
9079628 1997 HIV-1 tat inhibits the 20 S proteasome and its 11 S regulator-mediated activation.
8603043 1996 A component of the 26S proteasome binds on orphan member of the nuclear hormone receptor superfamily.
8500623 1993 Peptide sequencing identifies MSS1, a modulator of HIV Tat-mediated transactivation, as subunit 7 of the 26 S protease.
8419915 1993 The type 1 human immunodeficiency virus Tat binding protein is a transcriptional activator belonging to an additional family of evolutionarily conserved genes.
8323548 1993 Molecular cloning and developmental regulation of Dictyostelium discoideum homologues of the human and yeast HIV1 Tat-binding protein.
8076819 1994 The addition of 5'-coding information to a 3'-directed cDNA library improves analysis of gene expression.
8060531 1994 Tat-binding protein 7 is a subunit of the 26S protease.
2194290 1990 A cDNA for a protein that interacts with the human immunodeficiency virus Tat transactivator.