Property Summary

NCBI Gene PubMed Count 12
PubMed Score 12.15
PubTator Score 15.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -3.500 6.8e-06
osteosarcoma -3.741 2.5e-07
group 3 medulloblastoma 2.200 2.3e-04
primitive neuroectodermal tumor 1.300 6.4e-03
posterior fossa group B ependymoma 1.200 5.2e-04
nasopharyngeal carcinoma 1.200 2.4e-05
ovarian cancer 1.100 3.1e-04

 OMIM Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (10)

PMID Text
24481226 PSMC3IP gene mutations are not common causes of primary ovarian insufficiency in this Swedish cohort.
24097974 GT198 mutant luteinized theca cells overexpressing CYP17 are common in ovarian cancer stroma.
21963259 a PSMC3IP/HOP2 mutation may cause XX ovarian dysgenesis through abolishing coactivation of estrogen-driven transcription
19325002 findings suggest that a component of 19S regulatory particles directly binds AR and might participate in AR-mediated transcriptional activation in cooperation with TBPIP.
18941885 Observational study of gene-disease association. (HuGE Navigator)
16407260 Data suggest that the human TBPIP/Hop2-Mnd1 complex may ensure proper pairing between homologous chromosomes through its stimulation of strand exchange during meiosis.
16407260 Data suggest that the human TBPIP/Hop2-Mnd1 complex may ensure proper pairing between homologous chromosomes through its stimulation of strand exchange during meiosis [Hop2].
11739747 Identification of GT198 (TBPIP/Hop2) as a nuclear receptor coactivator. GT198 is phosphorylation regulated. GT198 interacts with nuclear receptors.
10806355 TBPIP is a cellular protein that interacts with Tat-binding protein-1 (TBP-1) and enhances the inhibitory action of TBP-1 on Tat-mediated transactivation of the HIV-1 LTR promoter
9345291 TBPIP is a cellular protein that interacts with Tat-binding protein-1 (TBP-1) and enhances the inhibitory action of TBP-1 on Tat-mediated transactivation of the HIV-1 LTR promoter

AA Sequence

MSKGRAEAAAGAAGILLRYLQEQNRPYSSQDVFGNLQREHGLGKAVVVKTLEQLAQQGKIKEKMYGKQKI      1 - 70
YFADQDQFDMVSDADLQVLDGKIVALTAKVQSLQQSCRYMEAELKELSSALTTPEMQKEIQELKKECAGY     71 - 140
RERLKNIKAATNHVTPEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYPKSKKQFFEEVGIETDEDY    141 - 210
NVTLPDP                                                                   211 - 217
//

Text Mined References (16)

PMID Year Title
24481226 2014 No mutations in the PSMC3IP gene identified in a Swedish cohort of women with primary ovarian insufficiency.
24097974 2013 Human ovarian cancer stroma contains luteinized theca cells harboring tumor suppressor gene GT198 mutations.
21963259 2011 XX ovarian dysgenesis is caused by a PSMC3IP/HOP2 mutation that abolishes coactivation of estrogen-driven transcription.
21269460 2011 Initial characterization of the human central proteome.
19325002 2009 Tat-binding protein-1 (TBP-1), an ATPase of 19S regulatory particles of the 26S proteasome, enhances androgen receptor function in cooperation with TBP-1-interacting protein/Hop2.
18941885 Two single nucleotide polymorphisms in PRDM9 (MEISETZ) gene may be a genetic risk factor for Japanese patients with azoospermia by meiotic arrest.
17716379 2007 Genomic and proteomic profiling I: leiomyomas in African Americans and Caucasians.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16407260 2006 Stimulation of DNA strand exchange by the human TBPIP/Hop2-Mnd1 complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11739747 2002 Identification and characterization of a tissue-specific coactivator, GT198, that interacts with the DNA-binding domains of nuclear receptors.
10806355 2000 Molecular cloning and characterization of a human homologue of TBPIP, a BRCA1 locus-related gene.
9345291 1997 Molecular cloning and characterization of a novel TBP-1 interacting protein (TBPIP):enhancement of TBP-1 action on Tat by TBPIP.
7490091 1995 Generation of a transcription map at the HSD17B locus centromeric to BRCA1 at 17q21.