Property Summary

NCBI Gene PubMed Count 69
PubMed Score 7.23
PubTator Score 16.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Alveolar soft part sarcoma 10 3.152 1.6

Expression

  Differential Expression (8)

Disease log2 FC p
dermatomyositis 1.400 3.2e-03
lung cancer -1.400 3.1e-03
malignant mesothelioma 1.100 1.4e-06
Multiple myeloma 1.562 4.3e-04
osteosarcoma 2.635 2.4e-06
ovarian cancer -1.500 3.1e-09
pancreatic ductal adenocarcinoma liver m... -1.598 4.5e-02
psoriasis 1.100 2.8e-04

Protein-protein Interaction (9)

PDB (22)

Gene RIF (28)

AA Sequence

MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDT      1 - 70
GLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRV     71 - 140
GVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPK    141 - 210
GVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAI    211 - 280
GGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEG    281 - 350
RTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSY    351 - 420
AKFSATPRYMTYN                                                             421 - 433
//

Text Mined References (79)

PMID Year Title