Property Summary

NCBI Gene PubMed Count 94
PubMed Score 236.53
PubTator Score 137.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.219 1.3e-02
Multiple myeloma 1.850 2.3e-04
malignant mesothelioma -2.100 5.4e-08
esophageal adenocarcinoma 1.200 1.8e-02
astrocytoma 1.300 2.4e-14
glioblastoma 2.800 3.8e-04
oligodendroglioma 1.200 8.7e-10
osteosarcoma -1.170 7.4e-03
posterior fossa group A ependymoma 2.100 5.3e-13
Duchenne muscular dystrophy 1.065 2.6e-10
limb girdle muscular dystrophy 2I 1.255 1.0e-02
juvenile dermatomyositis 3.347 4.5e-22
chronic kidney disease 1.200 1.8e-02
lung cancer -2.300 8.7e-06
active Crohn's disease 1.363 4.0e-03
pancreatic cancer 1.100 1.2e-03
interstitial cystitis 1.200 6.0e-03
pediatric high grade glioma 2.000 9.5e-07
pilocytic astrocytoma 2.300 9.0e-13
primary Sjogren syndrome 1.300 5.3e-03
subependymal giant cell astrocytoma 1.968 2.3e-02
lung carcinoma -1.300 7.7e-18
acute myeloid leukemia -1.300 4.5e-02
ovarian cancer 2.100 2.0e-04
dermatomyositis 2.100 8.8e-03

Gene RIF (90)

PMID Text
27156327 demonstrated that patients with the LMP-7 CA/AA genotypes were more likely to have advanced fibrosis scores than those bearing the CC genotype
27100179 Proteasome beta5i Subunit Deficiency Affects Opsonin Synthesis and Aggravates Pneumococcal Pneumonia.
25889472 lupus nephritis showed up-regulation of the immunoproteasome subunit LMP7 in tubular epithelial cells associated with type I interferon signature.
25098831 Comparison with reference profiles of sorted immune cells and healthy muscle confirmed upregulation of PSMB8 and -9 in myositis biopsies beyond infiltration related changes.
23283737 The LMP7 gene promoter methylation and protein downregulation were correlated at high extent in Kazakh's ESCC patients, and may explain the epigenetic regulation on gene expression.
23018640 Data indicate that treatment-emergent resistance to single-agent bortezomib was independent of variants in the proteasome genes PSMB1, PSMB5, PSMB6, PSMB8, PSMB9, and PSMB10.
22925930 The MAGE-C(2336-344) antigenic peptide is produced by the immunoproteasome and intermediate proteasome beta1i-beta5i, but not by the standard proteasome nor intermediate proteasome beta5i.
22037870 high risk of colon cancer was associated with LMP7-K/Q genotype and low risk with LMP7-Q/Q genotype; results suggest the presence of LMP7-K can reduce formation of immunoproteasomes and thus peptide processing, followed by reduced peptide-HLA presentation, a crucial factor in the immune response against cancer
21953331 CANDLE syndrome is caused by mutations in PSMB8, a gene recently reported to cause "JMP" syndrome in adults.
21881205 found a homozygous missense mutation (G197V) in immunoproteasome subunit, beta type 8 (PSMB8), which encodes one of the beta subunits induced by IFN-gamma in patients from 2 consanguineous families with lipodystrophy
21852578 Proteasome assembly defect due to a proteasome subunit beta type 8 (PSMB8) mutation causes the autoinflammatory disorder, Nakajo-Nishimura syndrome
21804012 we identified two single nucleotide polymorphisms within the beta5i/LMP7-encoding gene sequences, which were in strong linkage disequilibrium, as independent genetic risk factors for type 1 diabetes development in humans
21529441 In patients with primary Sjogren's syndrome, the expression of LMP7 (but not LMP2) is up-regulated in the labial gland.
21362330 HLA-I, TAP1, CNX, LMP7, Erp57, Tapasin and ERAP1 were down-regulated in 68%, 44%, 48%, 40%, 52%, 32% and 20% of esophageal squamous cell carcinoma lesions then, respectively.
21303409 the genetic variant within the LMP2/LMP7 gene would increase the risk of intestinal M. tuberculosis infection.
21129723 PSMB8 encodes a catalytic subunit of the 20S immunoproteasomes called beta5i. Immunoproteasome-mediated proteolysis generates immunogenic epitopes presented by major histocompatibility complex (MHC) class I molecules
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20525414 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20470844 In a southern Spanish population, no differences were observed in the frequencies of the LMP and TAP genotypes between brucellosis patients and controls.
20470844 Observational study of gene-disease association. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
20153157 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19619915 the reduced LMP7-mRNA level by HSV-1 could be of biological importance, since the virus could escape/hide from immune system of the host and establish latency processes.
19526842 LMP7 gene polymorphism showed identical frequency of different genotypes in hypertensive patients (Lys/Lys--92.4%, Lys/Gln--7.6%, Gln/Gln--0%) and healthy people (97.3%, 2.7%, 0% correspondingly; P = 0.16).
19526842 Observational study of gene-disease association. (HuGE Navigator)
19443843 the immunoproteasome appears to be a key link between inflammatory factors and the control of vascular cell apoptosis and may thus be an important factor in plaque rupture and myocardial infarction.
19443843 Interferon-induced PSMB8/LMP7 accelerates the degradation of Mcl-1 and increases the sensitivity of vascular lesion cells to apoptosis induced by fas ligation.
19404951 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19403671 HIV-1 CA downregulates PA28beta and the beta2i subunit of the immunoproteasome complex in a dendritic cell line (JAWS II), whereas in primary dendritic cells, PA28alpha, beta2i, and beta5i are downregulated by CA
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19202550 Observational study of gene-disease association. (HuGE Navigator)
19148137 Downregulation of LMP7 is associated with acute myeloid leukaemic blasts.
19065646 The different proteasome profiles of (IFN)DC and (IL-4)DC were associated with a greater ability of (IFN)DC to present an immunodominant epitope that requires LMP7 expression for its processing.
19037255 Patients with proteinuria greater than 0.5 g/1.73 m(2)/day had a significant switch of the chymotryptic-like beta5 protease to the LMP7 subunit, but this did not occur in patients with idiopathic nephrotic syndrome
18248301 Observational study of gene-disease association. (HuGE Navigator)
17703412 Observational study of gene-disease association. (HuGE Navigator)
17581627 Observational study of gene-disease association. (HuGE Navigator)
17581627 study found strong associations of psoriasis with variant alleles of LMP and TAP
17525827 Observational study of gene-disease association. (HuGE Navigator)
17525827 LMP7-145 site is associated with the risk of HBV infection.
17491658 Observational study of gene-disease association. (HuGE Navigator)
17142736 two inducible subunits of the proteasome, lmp2 and lmp7, are transcriptionally up-regulated by heat shock; heat-shocked cells show enhanced presentation of immunoproteasome-dependent MHC I antigenic epitopes, but not immunoproteasome-independent epitopes
16423992 Expression of LMP7E1 is cancer cells is an additional strategy of oncogenesis
16396320 Observational study of gene-disease association. (HuGE Navigator)
16338279 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16224524 Observational study of gene-disease association. (HuGE Navigator)
15907481 upregulation by IRF-1 and interferon gamma
15603870 Observational study of gene-disease association. (HuGE Navigator)
15488952 interaction of TAP1 and TAP2 and P-glycoprotein with proteasome subunits beta-5 and beta-5i suggest direct targeting of antigenic peptides to the ER via a TAP-proteasome association and a possible role for P-glycoprotein
15356131 HIV-1 CA downregulates PA28beta and the beta2i subunit of the immunoproteasome complex in a dendritic cell line (JAWS II), whereas in primary dendritic cells, PA28alpha, beta2i, and beta5i are downregulated by CA
14614829 HIV-1 CA downregulates PA28beta and the beta2i subunit of the immunoproteasome complex in a dendritic cell line (JAWS II), whereas in primary dendritic cells, PA28alpha, beta2i, and beta5i are downregulated by CA
14564014 HIV-1 CA downregulates PA28beta and the beta2i subunit of the immunoproteasome complex in a dendritic cell line (JAWS II), whereas in primary dendritic cells, PA28alpha, beta2i, and beta5i are downregulated by CA
14557625 HIV-1 CA downregulates PA28beta and the beta2i subunit of the immunoproteasome complex in a dendritic cell line (JAWS II), whereas in primary dendritic cells, PA28alpha, beta2i, and beta5i are downregulated by CA
14551602 LMP7 is associated with vitiligo.
14550573 HIV-1 CA downregulates PA28beta and the beta2i subunit of the immunoproteasome complex in a dendritic cell line (JAWS II), whereas in primary dendritic cells, PA28alpha, beta2i, and beta5i are downregulated by CA
14528301 HIV-1 CA downregulates PA28beta and the beta2i subunit of the immunoproteasome complex in a dendritic cell line (JAWS II), whereas in primary dendritic cells, PA28alpha, beta2i, and beta5i are downregulated by CA
14528300 HIV-1 CA downregulates PA28beta and the beta2i subunit of the immunoproteasome complex in a dendritic cell line (JAWS II), whereas in primary dendritic cells, PA28alpha, beta2i, and beta5i are downregulated by CA
14527406 HIV-1 CA downregulates PA28beta and the beta2i subunit of the immunoproteasome complex in a dendritic cell line (JAWS II), whereas in primary dendritic cells, PA28alpha, beta2i, and beta5i are downregulated by CA
12970355 HIV-1 CA downregulates PA28beta and the beta2i subunit of the immunoproteasome complex in a dendritic cell line (JAWS II), whereas in primary dendritic cells, PA28alpha, beta2i, and beta5i are downregulated by CA
12920286 HIV-1 CA downregulates PA28beta and the beta2i subunit of the immunoproteasome complex in a dendritic cell line (JAWS II), whereas in primary dendritic cells, PA28alpha, beta2i, and beta5i are downregulated by CA
12914693 HIV-1 CA downregulates PA28beta and the beta2i subunit of the immunoproteasome complex in a dendritic cell line (JAWS II), whereas in primary dendritic cells, PA28alpha, beta2i, and beta5i are downregulated by CA
12859895 HIV-1 CA downregulates PA28beta and the beta2i subunit of the immunoproteasome complex in a dendritic cell line (JAWS II), whereas in primary dendritic cells, PA28alpha, beta2i, and beta5i are downregulated by CA
12840737 HIV-1 CA downregulates PA28beta and the beta2i subunit of the immunoproteasome complex in a dendritic cell line (JAWS II), whereas in primary dendritic cells, PA28alpha, beta2i, and beta5i are downregulated by CA
12830140 HIV-1 CA downregulates PA28beta and the beta2i subunit of the immunoproteasome complex in a dendritic cell line (JAWS II), whereas in primary dendritic cells, PA28alpha, beta2i, and beta5i are downregulated by CA
12809610 HIV-1 CA downregulates PA28beta and the beta2i subunit of the immunoproteasome complex in a dendritic cell line (JAWS II), whereas in primary dendritic cells, PA28alpha, beta2i, and beta5i are downregulated by CA
12808466 HIV-1 CA downregulates PA28beta and the beta2i subunit of the immunoproteasome complex in a dendritic cell line (JAWS II), whereas in primary dendritic cells, PA28alpha, beta2i, and beta5i are downregulated by CA
12808465 HIV-1 CA downregulates PA28beta and the beta2i subunit of the immunoproteasome complex in a dendritic cell line (JAWS II), whereas in primary dendritic cells, PA28alpha, beta2i, and beta5i are downregulated by CA
12750511 HIV-1 CA downregulates PA28beta and the beta2i subunit of the immunoproteasome complex in a dendritic cell line (JAWS II), whereas in primary dendritic cells, PA28alpha, beta2i, and beta5i are downregulated by CA
12719574 HIV-1 CA downregulates PA28beta and the beta2i subunit of the immunoproteasome complex in a dendritic cell line (JAWS II), whereas in primary dendritic cells, PA28alpha, beta2i, and beta5i are downregulated by CA
12648225 Observational study of gene-disease association. (HuGE Navigator)
12519221 Impaired expression of proteasome subunits is involved in the loss of HLA class I expression in human colon cancer cells.
12419264 HIV-1 CA downregulates PA28beta and the beta2i subunit of the immunoproteasome complex in a dendritic cell line (JAWS II), whereas in primary dendritic cells, PA28alpha, beta2i, and beta5i are downregulated by CA
12225333 Observational study of gene-disease association. (HuGE Navigator)
12209365 Observational study of genotype prevalence. (HuGE Navigator)
12167863 HIV-1 CA downregulates PA28beta and the beta2i subunit of the immunoproteasome complex in a dendritic cell line (JAWS II), whereas in primary dendritic cells, PA28alpha, beta2i, and beta5i are downregulated by CA
11793848 Observational study of gene-disease association. (HuGE Navigator)
11793848 The frequencies of LMP7 genotypes and alleles showed no significant differences among different ages of diabetic onset.
11772516 Observational study of gene-disease association. (HuGE Navigator)
11737038 Observational study of gene-disease association. (HuGE Navigator)
11669176 Observational study of gene-disease association. (HuGE Navigator)
11494532 Observational study of gene-environment interaction. (HuGE Navigator)
11051286 Observational study of gene-disease association. (HuGE Navigator)
10893419 HIV-1 CA downregulates PA28beta and the beta2i subunit of the immunoproteasome complex in a dendritic cell line (JAWS II), whereas in primary dendritic cells, PA28alpha, beta2i, and beta5i are downregulated by CA
10358150 HIV-1 CA downregulates PA28beta and the beta2i subunit of the immunoproteasome complex in a dendritic cell line (JAWS II), whereas in primary dendritic cells, PA28alpha, beta2i, and beta5i are downregulated by CA
9846577 HIV-1 CA downregulates PA28beta and the beta2i subunit of the immunoproteasome complex in a dendritic cell line (JAWS II), whereas in primary dendritic cells, PA28alpha, beta2i, and beta5i are downregulated by CA
9811770 HIV-1 CA downregulates PA28beta and the beta2i subunit of the immunoproteasome complex in a dendritic cell line (JAWS II), whereas in primary dendritic cells, PA28alpha, beta2i, and beta5i are downregulated by CA
9079628 HIV-1 CA downregulates PA28beta and the beta2i subunit of the immunoproteasome complex in a dendritic cell line (JAWS II), whereas in primary dendritic cells, PA28alpha, beta2i, and beta5i are downregulated by CA

AA Sequence

MALLDVCGAPRGQRPESALPVAGSGRRSDPGHYSFSMRSPELALPRGMQPTEFFQSLGGDGERNVQIEMA      1 - 70
HGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYL     71 - 140
RNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGV    141 - 210
MDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ        211 - 276
//

Text Mined References (106)

PMID Year Title
27156327 2016 Low Molecular Mass Polypeptide 7 Single Nucleotide Polymorphism is Associated with the Progression of Liver Fibrosis in Patients Infected with Hepatitis C Virus Genotype 4.
27100179 2016 Proteasome ?5i Subunit Deficiency Affects Opsonin Synthesis and Aggravates Pneumococcal Pneumonia.
26567544 2016 CANDLE syndrome: chronic atypical neutrophilic dermatosis with lipodystrophy and elevated temperature-a rare case with a novel mutation.
26524591 2015 Additive loss-of-function proteasome subunit mutations in CANDLE/PRAAS patients promote type I IFN production.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25889472 2015 Local synthesis of interferon-alpha in lupus nephritis is associated with type I interferons signature and LMP7 induction in renal tubular epithelial cells.
25098831 2014 Upregulation of immunoproteasome subunits in myositis indicates active inflammation with involvement of antigen presenting cells, CD8 T-cells and IFN?.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23283737 2013 LMP gene promoter hypermethylation is a mechanism for its down regulation in Kazak's esophageal squamous cell carcinomas.
23018640 2012 Sequence analysis of ?-subunit genes of the 20S proteasome in patients with relapsed multiple myeloma treated with bortezomib or dexamethasone.
22925930 2012 Analysis of the processing of seven human tumor antigens by intermediate proteasomes.
22037870 2011 The LMP7-K allele of the immunoproteasome exhibits reduced transcript stability and predicts high risk of colon cancer.
21953331 2012 Mutations in proteasome subunit ? type 8 cause chronic atypical neutrophilic dermatosis with lipodystrophy and elevated temperature with evidence of genetic and phenotypic heterogeneity.
21881205 2011 A mutation in the immunoproteasome subunit PSMB8 causes autoinflammation and lipodystrophy in humans.
21852578 2011 Proteasome assembly defect due to a proteasome subunit beta type 8 (PSMB8) mutation causes the autoinflammatory disorder, Nakajo-Nishimura syndrome.
21804012 2011 Proteasome immunosubunits protect against the development of CD8 T cell-mediated autoimmune diseases.
21529441 2011 Expression of proteasome immunosubunit in labial glands of patients with primary Sjogren's syndrome.
21399633 2011 Genome-wide association study identifies susceptibility loci for IgA nephropathy.
21362330 2011 Association of defective HLA-I expression with antigen processing machinery and their association with clinicopathological characteristics in Kazak patients with esophageal cancer.
21303409 2011 LMP2/LMP7 gene variant: a risk factor for intestinal Mycobacterium tuberculosis infection in the Chinese population.
21269460 2011 Initial characterization of the human central proteome.
21129723 2010 PSMB8 encoding the ?5i proteasome subunit is mutated in joint contractures, muscle atrophy, microcytic anemia, and panniculitis-induced lipodystrophy syndrome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20525414 2011 Genetic variation in the LMP/TAP gene and outcomes of hepatitis B virus infection in the Chinese population.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20470844 2010 No association of TAP and LMP genetic polymorphism in human brucellosis and its complications.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20153157 2010 PSMB8 (LMP7) but not PSMB9 (LMP2) gene polymorphisms are associated to pigeon breeder's hypersensitivity pneumonitis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19619915 2009 Herpes simplex virus type I infection of mature dendritic cells leads to reduced LMP7-mRNA-expression levels.
19526842 2009 [Allele polymorphism of genes coding proteasome subunits is associated with an enhanced risk for arterial hypertension in adolescents].
19525961 2009 A selective inhibitor of the immunoproteasome subunit LMP7 blocks cytokine production and attenuates progression of experimental arthritis.
19443843 2009 Cardiovascular inflammation and lesion cell apoptosis: a novel connection via the interferon-inducible immunoproteasome.
19404951 2009 Association of a specific ERAP1/ARTS1 haplotype with disease susceptibility in ankylosing spondylitis.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19202550 2009 Single nucleotide polymorphisms in antigen processing machinery component ERAP1 significantly associate with clinical outcome in cervical carcinoma.
19148137 2009 In situ analysis of the antigen-processing machinery in acute myeloid leukaemic blasts by tissue microarray.
19065646 2009 Differential expression of constitutive and inducible proteasome subunits in human monocyte-derived DC differentiated in the presence of IFN-alpha or IL-4.
19037255 2009 Upregulation of the immunoproteasome in peripheral blood mononuclear cells of patients with IgA nephropathy.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18248301 2008 Variation in HLA class I antigen-processing genes and susceptibility to human papillomavirus type 16-associated cervical cancer.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17581627 2007 Strong associations of psoriasis with antigen processing LMP and transport genes TAP differ by gender and phenotype.
17525827 2007 Genetic polymorphisms of LMP/TAP gene and hepatitis B virus infection risk in the Chinese population.
17491658 2005 Genetic susceptibility to type 1 diabetes in the intracellular pathway of antigen processing - a subject review and cross-study comparison.
17262812 2007 Genome-wide gene expression differences in Crohn's disease and ulcerative colitis from endoscopic pinch biopsies: insights into distinctive pathogenesis.
17142736 2006 Heat shock up-regulates lmp2 and lmp7 and enhances presentation of immunoproteasome-dependent epitopes.
16423992 2006 Tumor cell lines expressing the proteasome subunit isoform LMP7E1 exhibit immunoproteasome deficiency.
16396320 [The frequency of allelic polymorphism of genes encoding immunoproteasome catalytic subunits in acute coronary syndrome patients].
16341674 2005 Transcriptome analysis of human gastric cancer.
16338279 2005 Pharmacogenomics of responsiveness to interferon IFN-beta treatment in multiple sclerosis: a genetic screen of 100 type I interferon-inducible genes.
16224524 2005 [Association between LMP2/LMP7 gene polymorphism and the infection of hepatitis B virus].
15944226 2005 IFN-gamma-induced immune adaptation of the proteasome system is an accelerated and transient response.
15907481 2005 IRF-1 mediates upregulation of LMP7 by IFN-gamma and concerted expression of immunosubunits of the proteasome.
15603870 2004 Association study of LMP gene polymorphisms in Mexican patients with spondyloarthritis.
15501285 2004 Potential effects of tetrodotoxin exposure to human glial cells postulated using microarray approach.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15488952 2005 Cytoplasmic domains of the transporter associated with antigen processing and P-glycoprotein interact with subunits of the proteasome.
15303969 2004 Hepatitis C virus non-structural protein NS3 interacts with LMP7, a component of the immunoproteasome, and affects its proteasome activity.
15231747 2004 A protein interaction framework for human mRNA degradation.
15029244 2004 Mammalian Cdh1/Fzr mediates its own degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14551602 2003 Genes of the LMP/TAP cluster are associated with the human autoimmune disease vitiligo.
14550573 2003 Human immunodeficiency virus-1 Tat protein interacts with distinct proteasomal alpha and beta subunits.
12791267 2003 Prophase destruction of Emi1 by the SCF(betaTrCP/Slimb) ubiquitin ligase activates the anaphase promoting complex to allow progression beyond prometaphase.
12648225 2003 Association of TAP and HLA-DM genes with psoriasis in Koreans.
12519221 2003 Impaired expression of proteasome subunits and human leukocyte antigens class I in human colon cancer cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12419264 2002 The RTP site shared by the HIV-1 Tat protein and the 11S regulator subunit alpha is crucial for their effects on proteasome function including antigen processing.
12225333 2002 A single nucleotide polymorphism of the low molecular mass polypeptide 7 gene influences the interferon response in patients with chronic hepatitis C.
12209365 2002 LMP2 and LMP7 gene polymorphism in Mexican populations: Mestizos and Amerindians.
11793848 2001 Relationship of large multifunctional proteasome 7 gene polymorphism with susceptibility to type 1 diabetes mellitus and DR3 gene.
11772516 Age dependent impact of LMP polymorphisms on TNFalpha-induced apoptosis in human peripheral blood mononuclear cells.
11737038 2001 Distribution of HLA-A, B alleles and polymorphisms of TAP and LMP genes in Korean patients with atopic dermatitis.
11717192 2001 Bipartite regulation of different components of the MHC class I antigen-processing machinery during dendritic cell maturation.
11669176 2001 Polymorphism in the MHC-encoded LMP7 gene: association with JRA without functional significance for immunoproteasome assembly.
11494532 2001 [Involvement of TAP2 and LMP7 gene polymorphisms in HCV infection].
11493458 2001 Tumor necrosis factor-alpha induces coordinated changes in major histocompatibility class I presentation pathway, resulting in increased stability of class I complexes at the cell surface.
11285280 2001 Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint.
11051286 2000 Assessment of the non-HLA-DR-DQ contribution to IDDM1 in British Caucasian families: analysis of LMP7 polymorphisms.
10975991 2000 Control of LMP7 expression in human endothelial cells by cytokines regulating cellular and humoral immunity.
10926487 2000 Characterisation of the newly identified human Ump1 homologue POMP and analysis of LMP7(beta 5i) incorporation into 20 S proteasomes.
10893419 2000 Degradation of HIV-1 integrase by the N-end rule pathway.
10657252 2000 Subcellular localization of proteasomes and their regulatory complexes in mammalian cells.
10329130 1999 Sequence information within proteasomal prosequences mediates efficient integration of beta-subunits into the 20 S proteasome complex.
9271825 1997 Proteasome subunits, low-molecular-mass polypeptides 2 and 7 are hyperexpressed by target cells in autoimmune thyroid disease but not in insulin-dependent diabetes mellitus: implications for autoimmunity.
9157092 1996 Two newly discovered alleles of major histocompatibility complex-encoded LMP7 in Korean populations.
9079628 1997 HIV-1 tat inhibits the 20 S proteasome and its 11 S regulator-mediated activation.
8811196 1996 Structure and functions of the 20S and 26S proteasomes.
8666937 1996 Newly identified pair of proteasomal subunits regulated reciprocally by interferon gamma.
8663318 1996 Proteasome subunits X and Y alter peptidase activities in opposite ways to the interferon-gamma-induced subunits LMP2 and LMP7.
8568858 1996 Evolutionary dynamics of non-coding sequences within the class II region of the human MHC.
8550087 1995 Cellular distribution of proteasome subunit Lmp7 mRNA and protein in human placentas.
8458375 1993 The major histocompatibility complex-encoded proteasome component LMP7: alternative first exons and post-translational processing.
8344725 1993 Different genomic structure of mouse and human Lmp7 genes: characterization of MHC-encoded proteasome genes.
8163024 1994 Replacement of proteasome subunits X and Y by LMP7 and LMP2 induced by interferon-gamma for acquirement of the functional diversity responsible for antigen processing.
7811265 1994 Human proteasome subunits from 2-dimensional gels identified by partial sequencing.
7498531 1995 Human lymphoblast and erythrocyte multicatalytic proteases: differential peptidase activities and responses to the 11S regulator.
1922342 1991 A proteasome-related gene between the two ABC transporter loci in the class II region of the human MHC.
1529427 1992 Nomenclature for factors of the HLA system, 1991. WHO Nomenclature Committee for factors of the HLA system.
1453454 1992 DNA sequence analysis of 66 kb of the human MHC class II region encoding a cluster of genes for antigen processing.
1429565 1992 Alternative exon usage and processing of the major histocompatibility complex-encoded proteasome subunits.