Property Summary

NCBI Gene PubMed Count 55
PubMed Score 4.72
PubTator Score 2.25

Knowledge Summary

Patent

No data available

Expression

 Compartment GO Term (0)

AA Sequence

MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMR      1 - 70
NGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTL     71 - 140
SILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS             141 - 201
//