Property Summary

NCBI Gene PubMed Count 9
PubMed Score 27.16
PubTator Score 2.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 3.3e-04
Disease Target Count Z-score Confidence
Thymoma 16 4.42 2.2
Thymic carcinoma 2 4.374 2.2
Patau syndrome 14 3.21 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.900 3.3e-04

Gene RIF (6)

AA Sequence

MALQDVCKWQSPDTQGPSPHLPRAGGWAVPRGCDPQTFLQIHGPRLAHGTTTLAFRFRHGVIAAADTRSS      1 - 70
CGSYVACPASCKVIPVHQHLLGTTSGTSADCATWYRVLQRELRLRELREGQLPSVASAAKLLSAMMSQYR     71 - 140
GLDLCVATALCGWDRSGPELFYVYSDGTRLQGDIFSVGSGSPYAYGVLDRGYRYDMSTQEAYALARCAVA    141 - 210
HATHRDAYSGGSVDLFHVRESGWEHVSRSDACVLYVELQKLLEPEPEEDASHAHPEPATAHRAAEDRELS    211 - 280
VGPGEVTPGDSRMPAGTETV                                                      281 - 300
//

Text Mined References (10)

PMID Year Title