Property Summary

NCBI Gene PubMed Count 53
PubMed Score 13.50
PubTator Score 11.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
gastric cancer 1.500 1.2e-03
hepatocellular carcinoma 1.400 5.2e-06
Waldenstrons macroglobulinemia 1.004 5.9e-03
astrocytic glioma -2.300 9.0e-03
ependymoma -2.100 2.9e-02
oligodendroglioma -2.200 1.9e-02
psoriasis 1.700 1.8e-04
glioblastoma -2.700 1.2e-04
osteosarcoma -1.119 2.1e-02
medulloblastoma -2.400 3.2e-05
atypical teratoid / rhabdoid tumor -2.900 5.9e-07
medulloblastoma, large-cell -3.200 9.5e-05
primitive neuroectodermal tumor -1.800 2.2e-03
pancreatic ductal adenocarcinoma liver m... -1.683 3.7e-03
tuberculosis and treatment for 6 months -1.300 7.5e-04
non-small cell lung cancer -1.359 6.9e-24
intraductal papillary-mucinous adenoma (... 1.600 5.7e-03
intraductal papillary-mucinous carcinoma... 1.600 7.9e-03
intraductal papillary-mucinous neoplasm ... 1.700 3.2e-02
lung cancer 1.600 1.7e-03
diabetes mellitus -1.400 2.1e-03
cystic fibrosis -1.400 1.4e-03
pediatric high grade glioma -2.100 5.1e-05
pilocytic astrocytoma -1.500 2.2e-04
Alzheimer's disease -1.500 4.4e-02
Pick disease -2.000 9.8e-04
invasive ductal carcinoma 1.100 4.7e-04
ovarian cancer 1.800 1.1e-03
pituitary cancer 1.600 5.9e-05

Gene RIF (26)

PMID Text
18854154 Knockdown of proteasome (prosome, macropain) subunit, alpha type, 5 (PSMA5) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
14614829 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
14564014 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
14557625 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
14550573 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
14528301 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
14528300 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
14527406 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
12970355 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
12920286 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
12914693 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
12859895 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
12840737 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
12830140 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
12809610 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
12808466 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
12808465 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
12750511 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
12719574 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
12419264 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
12167863 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
11771738 Selective upregulation of the ubiquitin-proteasome proteolytic pathway proteins, proteasome zeta chain and isopeptidase T in fetal Down syndrome.
10893419 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
9846577 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
9811770 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
9079628 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication

AA Sequence

MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEI      1 - 70
DAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVA     71 - 140
LLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKL    141 - 210
NATNIELATVQPGQNFHMFTKEELEEVIKDI                                           211 - 241
//

Text Mined References (64)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19734940 2009 Increased proteasome subunit protein expression and proteasome activity in colon cancer relate to an enhanced activation of nuclear factor E2-related factor 2 (Nrf2).
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17948026 2007 The proteasome maturation protein POMP facilitates major steps of 20S proteasome formation at the endoplasmic reticulum.
17323924 2007 Mass spectrometric characterization of the affinity-purified human 26S proteasome complex.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16341674 2005 Transcriptome analysis of human gastric cancer.
16251969 2005 A heterodimeric complex that promotes the assembly of mammalian 20S proteasomes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15225636 2004 The alpha4 and alpha7 subunits and assembly of the 20S proteasome.
15029244 2004 Mammalian Cdh1/Fzr mediates its own degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14614829 2003 The Vif protein of HIV triggers degradation of the human antiretroviral DNA deaminase APOBEC3G.
14564014 2003 Induction of APOBEC3G ubiquitination and degradation by an HIV-1 Vif-Cul5-SCF complex.
14557625 2003 The human immunodeficiency virus type 1 Vif protein reduces intracellular expression and inhibits packaging of APOBEC3G (CEM15), a cellular inhibitor of virus infectivity.
14550573 2003 Human immunodeficiency virus-1 Tat protein interacts with distinct proteasomal alpha and beta subunits.
14528301 2003 HIV-1 Vif protein binds the editing enzyme APOBEC3G and induces its degradation.
14528300 2003 The antiretroviral enzyme APOBEC3G is degraded by the proteasome in response to HIV-1 Vif.
14527406 2003 HIV-1 Vif blocks the antiviral activity of APOBEC3G by impairing both its translation and intracellular stability.
12970355 2003 The enzymatic activity of CEM15/Apobec-3G is essential for the regulation of the infectivity of HIV-1 virion but not a sole determinant of its antiviral activity.
12920286 2003 Virology. Weapons of mutational destruction.
12914693 2003 Death by deamination: a novel host restriction system for HIV-1.
12859895 2003 Species-specific exclusion of APOBEC3G from HIV-1 virions by Vif.
12840737 2003 Good to CU.
12830140 2003 DNA deamination: not just a trigger for antibody diversification but also a mechanism for defense against retroviruses.
12809610 2003 DNA deamination mediates innate immunity to retroviral infection.
12808466 2003 Broad antiretroviral defence by human APOBEC3G through lethal editing of nascent reverse transcripts.
12808465 2003 The cytidine deaminase CEM15 induces hypermutation in newly synthesized HIV-1 DNA.
12791267 2003 Prophase destruction of Emi1 by the SCF(betaTrCP/Slimb) ubiquitin ligase activates the anaphase promoting complex to allow progression beyond prometaphase.
12750511 2003 Hypermutation of HIV-1 DNA in the absence of the Vif protein.
12719574 2003 Comprehensive investigation of the molecular defect in vif-deficient human immunodeficiency virus type 1 virions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12419264 2002 The RTP site shared by the HIV-1 Tat protein and the 11S regulator subunit alpha is crucial for their effects on proteasome function including antigen processing.
12167863 2002 Isolation of a human gene that inhibits HIV-1 infection and is suppressed by the viral Vif protein.
11771738 2001 Selective upregulation of the ubiquitin-proteasome proteolytic pathway proteins, proteasome zeta chain and isopeptidase T in fetal Down syndrome.
11285280 2001 Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint.
11205743 2001 Polo-like kinase interacts with proteasomes and regulates their activity.
10893419 2000 Degradation of HIV-1 integrase by the N-end rule pathway.
10363657 1999 Proteasome subunit zeta, a putative ribonuclease, is also found as a free monomer.
9846577 1998 Evidence for a newly discovered cellular anti-HIV-1 phenotype.
9811770 1998 An endogenous inhibitor of human immunodeficiency virus in human lymphocytes is overcome by the viral Vif protein.
9530635 1998 Twelve genes, including the unassigned proteasome zeta subunit gene, ordered within the human 1p13 region.
9079628 1997 HIV-1 tat inhibits the 20 S proteasome and its 11 S regulator-mediated activation.
8811196 1996 Structure and functions of the 20S and 26S proteasomes.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7811265 1994 Human proteasome subunits from 2-dimensional gels identified by partial sequencing.
1888762 1991 The primary structures of four subunits of the human, high-molecular-weight proteinase, macropain (proteasome), are distinct but homologous.
1286667 1992 Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes.