Property Summary

NCBI Gene PubMed Count 107
PubMed Score 369.25
PubTator Score 616.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
hepatocellular carcinoma -1.100 2.8e-03
Waldenstrons macroglobulinemia 1.166 1.9e-02
malignant mesothelioma -4.200 1.9e-07
astrocytic glioma -1.800 4.0e-02
psoriasis -1.300 7.4e-04
posterior fossa group A ependymoma -1.300 1.8e-03
group 4 medulloblastoma 1.600 5.6e-04
atypical teratoid / rhabdoid tumor -2.100 9.7e-07
glioblastoma -2.200 9.9e-05
medulloblastoma, large-cell -2.100 4.5e-06
tuberculosis and treatment for 6 months 1.100 2.0e-04
lung cancer 1.300 4.2e-04
adult high grade glioma -1.500 9.6e-03
primary Sjogren syndrome 1.300 2.0e-03
lung adenocarcinoma -1.500 1.1e-09
progressive supranuclear palsy -1.400 1.6e-02
invasive ductal carcinoma -1.200 2.8e-03
ovarian cancer -1.900 4.8e-05
Down syndrome 1.100 4.2e-04
dermatomyositis 1.200 1.3e-03

Protein-protein Interaction (1)

Gene RIF (243)

PMID Text
26771192 LEDGF/p75 Overexpression Attenuates Oxidative Stress-Induced Necrosis and Upregulates the Oxidoreductase ERP57/PDIA3/GRP58 in Prostate Cancer
26545813 LEDGF/p75 interacts with splicing factors, contributes to exon choice, and directs HIV-1 integration to transcription units that are highly spliced.
26245978 common LEDGF/p75 interaction interface shared by JPO2, PogZ, MLL1, IWS1 and HIV IN
26245978 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
26235378 Results show that these antibodies are highly specific for dense fine speckles 70 protein DFS70/LEDGFp75 and do not target methyl CpG binding protein 2 (MeCP2).
25809198 Together, these results provide evidence for an Integrase/Pol mediated uptake of LEDGF/p75 in HIV-1 viral particles and a specific cleavage by HIV protease.
25809198 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
25778682 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
25705574 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
25590759 Altogether, these results indicate that a complex containing LEDGF/p75, Iws1, and Spt6 participates in regulating postintegration steps of HIV latency.
25590759 Knockdown of LEDGF/p75 by shRNA enhances HIV-1 replication in HIV-1-infected CD4+ T-cells and latently infected cells
25555456 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
25486307 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
25462529 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
25383358 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
25322565 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
25305204 Data show that the same site on integrase-binding domain (IBD) of lens epithelium-derived growth factor (LEDGF) is involved in binding to MLL protein and HIV-IN (integrase), indicating an approach to target LEDGF in both leukemia and HIV infection.
25231459 LEDGF and 44 other novel putative nuclear targets of human thioredoxin 1 have been identified.
25230778 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
25224008 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
25147212 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
25118283 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
25082813 Authors identified an additional LEDGF/p75-MLL interface, which overlaps with the binding site of known LEDGF/p75 interactors-HIV-1 integrase, PogZ, and JPO2.
25072705 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
25047784 Results of the present work reinforce the association of PSIP1 gene and rs61744944 single nucleotide polymorphism with HIV-1 infection long-term nonprogressors status.
24954548 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
24904063 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
24874515 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
24820090 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
24794743 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
24634210 Data indicate that JPO2 and LEDGF/p75 interact directly and specifically in vivo through the specific interaction domain of JPO2 and the C-terminal domain of LEDGF/p75.
24618511 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
24604027 LEDGF is crucial for the growth and survival of HPV-positive cancer cells
24599328 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
24480521 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
24451643 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
24389668 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
24381568 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
24312278 a regulation of LEDGF interaction with chromatin by cellular partners of its PWWP domain could be involved in several processes linked to LEDGF tethering properties, such as lentiviral integration, DNA repair or transcriptional regulation
24261564 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
24051001 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
24014475 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
23994868 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
23985689 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
23863879 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
23859152 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
23803661 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
23799881 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
23758584 Data indicate that the stabilized peptides inhibit the interaction of HIV-1 integrase (IN) with the cellular cofactor LEDGF/p75.
23758584 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
23721378 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
23671082 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
23610442 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
23593299 LEDGF organizes and stabilizes an active integrase tetramer suitable for specific viral DNA integration.
23593299 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
23445471 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
23369367 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
23306052 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
23226247 The observed variation in LEDGF/p75 expression was not correlated with the disease progression.
23217620 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
23211777 Although identified in a cohort of long-term nonprogressors, our study did not indicate that the I436S or T473I mutation in LEDGF/p75 affects the interaction with HIV-1 integrase.
23138933 conclude that FBXO10, a candidate breast cancer susceptibility associated gene, is induced by cellular stress and LEDGF may play a role in expression of this gene
23097450 A role for the human immunodeficiency virus type 1 capsid CA protein in determining the dependency of HIV-1 on LEDGF/p75 during infection highlights a connection between the viral capsid and chromosomal DNA integration.
23097450 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
23046603 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
23046280 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
23043109 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
23024700 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
22928108 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
22872640 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
22808106 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
22803661 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
22773103 Depletion of LEDGF impairs the recruitment of C-terminal binding protein interacting protein (CtIP) to DNA DSBs and the subsequent CtIP-dependent DNA-end resection.
22762018 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
22748127 findings provide insights into the regulation and regulatory functions of LEDGF in Sumoylation-dependent transcriptional control that may be essential for modifying the physiology of cells to maintain cellular homeostasis
22733274 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
22664975 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
22647853 Collectively, results reveal the involvement of LEDGF-mediated elevated expression of Hsp27-dependent survival pathway(s) in prostate cancer
22615874 Cotransfection studies with Sp1 in Drosophila cells that were Sp1-deficient, showed increased LEDGF/p75 transcription.
22615581 We propose that Psip1/p52, through its binding to both chromatin and splicing factors, might act to modulate splicing
22535962 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
22479480 reduced LEDGF/p75 levels may play a role in resistance to HIV-1 infection.
22437836 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
22421880 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
22334021 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
22317832 findings suggest that genetic variation in LEDGF may influence susceptibility to HIV-1 infection and disease progression, which provides in-vivo evidence that LEDGF/p75 is an important host cofactor for HIV-1 replication
22291694 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
22278243 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
22276150 Results further establish LEDGF/p75 as a cancer-related protein, and provide a rationale for ongoing studies aimed at understanding the clinical significance of its expression in specific human cancers.
22275515 The LEDGF/p75-MeCP2 interaction differentially influences Hsp27pr activation depending on the cellular and molecular context.
22190034 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
22103895 The fusion genes combining NUP98 exon 11/12 with PSIP1 exon 8 may be implicated in the pathogenesis of myelodysplastic syndrome (MDS).
22019592 Computational, biochemical, and genetic approaches enabled us to identify the transcription factor Sp1 as a key modulator of the PSIP1 promoter, controlling LEDGF/p75 transcription through two binding sites
21994603 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
21994569 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
21987578 Role of the PWWP domain of lens epithelium-derived growth factor (LEDGF)/p75 cofactor in lentiviral integration targeting.
21987578 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
21915354 P23H rhodopsin as well as WT rhodopsin form aggregates in RPE cells and LEDGF(1-326) decreases these aggregates. Further, LEDGF(1-326) reduces the RPE cell damage caused by P23H rhodopsin.
21875413 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
21784078 The memory subset of CD4+ T cells showed significantly higher expression levels of APOBEC3G, TRIM5alpha, and LEDGF/p75.
21778063 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
21771857 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
21763490 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
21681054 Association of polymorphisms in the LEDGF/p75 gene (PSIP1) with susceptibility to HIV-1 infection and disease progression may affect patients outcomes.
21676593 LEDGF/DFS70 activates the MK2/IL6/STAT3 pathway in HaCaT keratinocytes.
21623867 We confirm that p75 is useful in differentiating atypical fibroxanthoma from spindle cell melanoma.
21510906 The effect of HIV-1 integrase on the chromatin binding of LEDGF/p75 requires the direct interaction of these two proteins.
21510906 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
21506277 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
21409951 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
21329475 We conclude that serum IgE-anti-DFS70 autoantibodies (aAbs) and IgG(4)-anti-DFS70 aAbs may be related to the severity of atopic dermatitis.
21270171 LEDGF dominant interference and depletion impair HIV-1 integration at distinct postentry stages.
21270171 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
21222490 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
21156026 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
21152581 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
20974633 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
20850978 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
20719241 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
20712566 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
20678206 It appears that the lack of integration observed in HIV-1 infected LEDGF/p75-knockdown cells is due mainly to the inhibitory effect of Rev following the formation of a Rev-integrase complex.
20631726 ectopic expression of LEDGF/DFS70 in keratinocytes could be involved in the pathology of psoriasis vulgaris
20538907 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
20473303 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
20406807 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
20382164 Lysine to arginine mutations of the identified SUMO acceptor sites drastically inhibited LEDGF/p75 SUMOylation and significantly increased its transcriptional activity on the heat shock protein 27 promoter.
20367881 These data suggest that a structural rearrangement or oligomerization of the HIV-1 integrase protein occurs during the early steps of infection and that this process is related to the presence of LEDGF/p75.
20367881 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
20331877 All of these data indicate that, even though the presence of LEDGF/p75 is important for a productive replication, HIV-1 integrase has the ability to bind chromatin in a LEDGF/p75-independent manner and sustains a low level of HIV-1 infection.
20331877 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
20171172 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
20133638 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
20018238 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
20016921 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
19934313 Chromatin immunoprecipitation showed that LEDGF/p75 binds the VEGF-C promoter, and binding is augmented by FSH. A corresponding hormonally regulated increase in the LEDGF/p75 mRNA and protein levels was observed.
19889764 These results clearly indicated that serine residues 271, 273, and 275 influence the HIV-1 cofactor activity of integrase-to-chromatin-tethering-competent LEDGF/p75.
19889764 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
19864417 The interaction with LEDGF relieves autoinhibition of Cdc7-ASK kinase, imposed by the C terminus of ASK.
19855849 Results show that HIV-1 Rev promotes dissociation of the IN-LEDGF/p75 complex. Combination of the viral IN and the cellular LEDGF/p75 is required for proper integration of the viral cDNA into the host chromosomal DNA.
19855849 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
19836475 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
19801648 Study revealed the significantly tighter nature of the IN-IN dimer compared with the IN-LEDGF interaction.
19801648 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
19750561 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
19715609 Results point to LEDGF/p75 as a potential contributor to cellular resistance to docetaxel-induced lysosomal destabilization and cell death, and an attractive candidate for molecular targeting in HRPC.
19609362 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
19609359 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
19565598 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
19401538 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
19389610 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
19244240 LEDGF/p75 has a role in DDE domain protein function and interacts with the transposase-derived DDE domain of PogZ
19244240 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
19232540 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
19229293 A functional complex between the wild-type full-length integrase (IN) and the cellular cofactor LEDGF/p75 showed enhanced in vitro integration activity compared with the integrase alone.
19229293 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
19132083 structural basis for the high affinity lentiviral IN-LEDGF interaction
19132083 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
19119323 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
19081927 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
19049878 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
19020832 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
19020831 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
19015031 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
19014595 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
18801737 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
18799576 a number of PWWP domain residues, highlighted by Trp-21 and Ala-51, which play critical roles in LEDGF/p75-dependent HIV-1 infection and integration.
18799576 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
18789977 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
18708362 LEDGF/p75 and p52 seem to play antagonistic roles in the cellular stress response and could serve as targets for novel antitumor therapies.
18691555 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
18598942 LEDGF critically associates with mixed-lineage leukemia protein and menin at the nexus of transcriptional pathways that are recurrently targeted in diverse diseases.
18480474 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
18369482 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
18264802 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
18247352 it could be suggested that residues Gln168, Glu170, and Thr174 in chain A of IN, Thr125, and Trp131 in chain B of IN as well as Ile365, Asp366, Phe406, and Val408 in LEDGF/p75 were responsible for their binding with HIV-1 integrase
18247352 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
18174227 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
18092005 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
18036557 Furthermore, results indicate that induction of apoptosis in HCT-116 p53(wt) cells after ibuprofen treatment is in part dependent on a signalling pathway including the neutrophin receptor p75(NTR), p53 and Bax.
17804545 some DFS70-positive sera have antibodies that recognize antigens of the lens
17669426 Over-expression of JPO2 resulted in a modest but reproducible inhibition of HIV-1 replication, consistent with competition between integrase and JPO2 for binding to LEDGF/p75
17669426 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
17639082 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
17488811 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
17451600 Analysis of blasts from single patients disclosed that LEDGF/p75 was the most consistently upregulated mRNA in resistant acute myelogenous leukemia.
17397262 The complementary inhibition by LEDGF/p75 knockdown and mutagenesis at the integrase-LEDGF/p75 interface points to the incapability of HIV to circumvent LEDGF/p75 function during proviral integration.
17397262 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
17328897 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
17320002 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
17304248 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
17298035 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
17267486 Our data show that LEDGF differentially affects HIV-1 integrase-DNA complexes mediating single-ended viral DNA integration and synaptic complexes mediating concerted integration.
17267486 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
17258258 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
17172465 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
17158150 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
17137594 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
17083721 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
16987986 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
16959972 findings show that (LEDGF)/p75 (p75) is an essential HIV integration cofactor; the mechanism requires both linkages of a molecular tether that p75 forms between integrase and chromatin
16959972 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
16959283 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
16793062 The results establish a molecular mechanism for LEDGF/p75-mediated tethering of HIV-1 integrase to chromatin.
16793062 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
16735438 The role for p75 in the Myc regulatory network, and indicate that p75 is a general adaptor protein tethering divergent factors to chromatin through its versatile integrase-binding domain.
16735438 LEDGF (PSIP1) binds and tethers the Myc-interacting protein JPO2/RAM2 to chromatin.
16439544 data validate LEDGF/p75 as an important cellular cofactor for HIV integration
16439544 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
16403949 Results suggest that TNF-alpha elevates the expression of lens epithelium-derived growth factor (LEDGF) and that LEDGF is one of the transactivators of gamma-glutamylcysteine synthetase heavy subunit gene.
16403635 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
16337983 Here, we show that recombinant LEDGF host cell factor efficiently reconstitutes the in vitro activity of HIV-1 preintegration complexes.
16337983 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
16314581 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
16311605 LEDGF is thus the first example of a cellular protein controlling the location of HIV integration in human cells.
16311605 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
16260736 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
16075307 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
15895093 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
15875659 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
15855167 LEDGF/p75 tethers HIV-1 integrase to chromosomes and that this interaction may be important for the integration process and the replication of HIV-1
15855167 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
15797927 LEDGF/p75 is a multidomain adaptor protein that interacts with the nuclear import apparatus, lentiviral IN proteins and chromatin by means of an NLS, an IBD and additional chromatin-interacting domains.
15797927 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
15788449 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
15749713 Whereas LEDGF/p75 displayed only a moderate affinity for DNA, it strongly promoted the binding of HIV-1 integrase to DNA. This effect was specific for the p75 isoform of LEDGF and was not seen with p52.
15749713 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
15725483 A novel fusion of the NUP98 and LEDGF genes in a pediatric case of acute myeloid leukemia.
15501396 autoantibodies against the DFS70 are related to the etiology in a certain population of Alopecia areata
15501393 Circular dichroism analysis revealed that DFS(349-435) contains an approximately 40% alpha-helical conformation
15475359 Lens epithelium-derived growth factor/p75 prevents proteasomal degradation of HIV-1 integrase
15475359 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
15371438 LEDGF/p75 and HRP2 IBDs avidly bind HIV-1 Integrase, share a similar domain organization and have an evident evolutionary and likely functional relationship
15308744 LEDGF/p75 fully accounts for cellular trafficking of diverse lentiviral, but not oncoretroviral, integrases and is the main lentiviral integrase-to-chromatin tethering factor
15308744 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
15163664 lens epithelium-derived growth factor (LEDGF)/p75 LEDGF/p75 NLS, 148GRKRKAEKQ156, belongs to the canonical SV40 large T antigen-like family nuclear localization signal (NLS)
15163664 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
12796494 the interaction with LEDGF/p75 accounts for the karyophilic properties and chromosomal targeting of HIV-1 integrase
12796494 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
12407101 HIV-1 integrase associates with LEDGF/p75 in human cells. Integrase co-localizes with endogenous LEDGF/p75 in nuclei and on condensed chromosomes in mitotic cells. LEDGF/p75 stimulates integrase activity in vitro.
12407101 PSIP1 (LEDGF/p75) L368A mutant demonstrates reduced binding to HIV-1 IN
12181742 LEDGF/p75 protected cells from cell death, whereas the 65 kD fragment failed to protect. The apoptotic cleavage of LEDGF/p75 may cause atopic disorders by abrogating its pro-survival function and enhancing its immunogenicity.
9885563 PSIP1/p52 is expressed from the same gene as PSIP2/LEDGF/p75 due to alternative splicing of the pre-mRNA. It has transcription co-activator activity in vitro and can functionally interact with the ASF/SF2 splicing factor in vitro.
9822615 PSIP2/LEDGF/p75 co-purifies with transcription coactivator PC4 from HeLa cell extract. PSIP2 and PSIP1 interact with VP16 activation domain and several components of the general transcription machinery in vitro.

AA Sequence

MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIFPYSENKEKYGK      1 - 70
PNKRKGFNEGLWEIDNNPKVKFSSQQAATKQSNASSDVEVEEKETSVSKEDTDHEEKASNEDVTKAVDIT     71 - 140
TPKAARRGRKRKAEKQVETEEAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDI    141 - 210
ITEEDKSKKKGQEEKQPKKQPKKDEEGQKEEDKPRKEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGD    211 - 280
DQEGEKKRKGGRNFQTAHRRNMLKGQHEKEAADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDS    281 - 350
RLQRIHAEIKNSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLY    351 - 420
NKFKNMFLVGEGDSVITQVLNKSLAEQRQHEEANKTKDQGKKGPNKKLEKEQTGSKTLNGGSDAQDGNQP    421 - 490
QHNGESNEDSKDNHEASTKKKPSSEERETEISLKDSTLDN                                  491 - 530
//

Text Mined References (125)

PMID Year Title
26771192 2016 LEDGF/p75 Overexpression Attenuates Oxidative Stress-Induced Necrosis and Upregulates the Oxidoreductase ERP57/PDIA3/GRP58 in Prostate Cancer.
26545813 2015 LEDGF/p75 interacts with mRNA splicing factors and targets HIV-1 integration to highly spliced genes.
26245978 2015 Multiple cellular proteins interact with LEDGF/p75 through a conserved unstructured consensus motif.
26235378 2015 Specificity of antinuclear autoantibodies recognizing the dense fine speckled nuclear pattern: Preferential targeting of DFS70/LEDGFp75 over its interacting partner MeCP2.
25809198 2015 HIV-1 IN/Pol recruits LEDGF/p75 into viral particles.
25590759 2015 The integrase cofactor LEDGF/p75 associates with Iws1 and Spt6 for postintegration silencing of HIV-1 gene expression in latently infected cells.
25305204 2014 The same site on the integrase-binding domain of lens epithelium-derived growth factor is a therapeutic target for MLL leukemia and HIV.
25231459 2014 Identification of novel nuclear targets of human thioredoxin 1.
25082813 2014 Validation and structural characterization of the LEDGF/p75-MLL interface as a new target for the treatment of MLL-dependent leukemia.
25047784 2014 Association of single nucleotide polymorphisms in the lens epithelium-derived growth factor (LEDGF/p75) with HIV-1 infection outcomes in Brazilian HIV-1+ individuals.
24634210 2014 Dynamics of the ternary complex formed by c-Myc interactor JPO2, transcriptional co-activator LEDGF/p75, and chromatin.
24604027 2014 Oncogenic human papillomaviruses activate the tumor-associated lens epithelial-derived growth factor (LEDGF) gene.
24312278 2013 TOX4 and NOVA1 proteins are partners of the LEDGF PWWP domain and affect HIV-1 replication.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23758584 2013 Design of cell-permeable stapled peptides as HIV-1 integrase inhibitors.
23593299 2013 Structural and functional role of INI1 and LEDGF in the HIV-1 preintegration complex.
23226247 2012 Characterization of LEDGF/p75 genetic variants and association with HIV-1 disease progression.
23211777 2013 Characterization of rare lens epithelium-derived growth factor/p75 genetic variants identified in HIV-1 long-term nonprogressors.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23138933 2014 Human MCS5A1 candidate breast cancer susceptibility gene FBXO10 is induced by cellular stress and correlated with lens epithelium-derived growth factor (LEDGF).
23097450 2013 Differential effects of human immunodeficiency virus type 1 capsid and cellular factors nucleoporin 153 and LEDGF/p75 on the efficiency and specificity of viral DNA integration.
22872640 2012 Interaction of the HIV-1 intasome with transportin 3 protein (TNPO3 or TRN-SR2).
22773103 2012 LEDGF (p75) promotes DNA-end resection and homologous recombination.
22748127 2012 Lens epithelium-derived growth factor deSumoylation by Sumo-specific protease-1 regulates its transcriptional activation of small heat shock protein and the cellular response.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22647853 2012 LEDGF gene silencing impairs the tumorigenicity of prostate cancer DU145 cells by abating the expression of Hsp27 and activation of the Akt/ERK signaling pathway.
22615874 2012 Transcriptional protein Sp1 regulates LEDGF transcription by directly interacting with its cis-elements in GC-rich region of TATA-less gene promoter.
22615581 2012 Psip1/Ledgf p52 binds methylated histone H3K36 and splicing factors and contributes to the regulation of alternative splicing.
22479480 2012 Expression analysis of LEDGF/p75, APOBEC3G, TRIM5alpha, and tetherin in a Senegalese cohort of HIV-1-exposed seronegative individuals.
22317832 2012 Rare LEDGF/p75 genetic variants in white long-term nonprogressor HIV+ individuals.
22276150 2012 Expression of the stress response oncoprotein LEDGF/p75 in human cancer: a study of 21 tumor types.
22275515 2012 The stress oncoprotein LEDGF/p75 interacts with the methyl CpG binding protein MeCP2 and influences its transcriptional activity.
22103895 2012 Expression of the novel NUP98/PSIP1 fusion transcripts in myelodysplastic syndrome with t(9;11)(p22;p15).
22019592 2011 LEDGF/p75 TATA-less promoter is driven by the transcription factor Sp1.
21987578 2011 Role of the PWWP domain of lens epithelium-derived growth factor (LEDGF)/p75 cofactor in lentiviral integration targeting.
21915354 2011 LEDGF(1-326) decreases P23H and wild type rhodopsin aggregates and P23H rhodopsin mediated cell damage in human retinal pigment epithelial cells.
21784078 2011 Intracellular detection of differential APOBEC3G, TRIM5alpha, and LEDGF/p75 protein expression in peripheral blood by flow cytometry.
21681054 2011 Association of polymorphisms in the LEDGF/p75 gene (PSIP1) with susceptibility to HIV-1 infection and disease progression.
21676593 2011 LEDGF/DFS70 activates the MK2/IL6/STAT3 pathway in HaCaT.
21623867 2011 Diagnostic utility of low-affinity nerve growth factor receptor (P 75) immunostaining in atypical fibroxanthoma.
21510906 2011 HIV-1 integrase modulates the interaction of the HIV-1 cellular cofactor LEDGF/p75 with chromatin.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21329475 2011 IgE and IgG(4) autoantibodies against DFS70/LEDGF in atopic dermatitis.
21270171 2011 LEDGF dominant interference proteins demonstrate prenuclear exposure of HIV-1 integrase and synergize with LEDGF depletion to destroy viral infectivity.
21269460 2011 Initial characterization of the human central proteome.
21156026 2011 Peptides that bind the HIV-1 integrase and modulate its enzymatic activity--kinetic studies and mode of action.
20974633 2011 The transcriptional co-activator LEDGF/p75 displays a dynamic scan-and-lock mechanism for chromatin tethering.
20678206 2010 Peptides derived from the HIV-1 integrase promote HIV-1 infection and multi-integration of viral cDNA in LEDGF/p75-knockdown cells.
20631726 2010 Overexpression of LEDGF/DFS70 induces IL-6 via p38 activation in HaCaT cells, similar to that seen in the psoriatic condition.
20382164 2010 SUMOylation of the lens epithelium-derived growth factor/p75 attenuates its transcriptional activity on the heat shock protein 27 promoter.
20367881 2010 Changes in the accessibility of the HIV-1 Integrase C-terminus in the presence of cellular proteins.
20331877 2010 Characterization of the HIV-1 integrase chromatin- and LEDGF/p75-binding abilities by mutagenic analysis within the catalytic core domain of integrase.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19934313 2009 Gonadotropin-regulated lymphangiogenesis in ovarian cancer is mediated by LEDGF-induced expression of VEGF-C.
19889764 2010 Implication of serine residues 271, 273, and 275 in the human immunodeficiency virus type 1 cofactor activity of lens epithelium-derived growth factor/p75.
19864417 2010 Transcriptional co-activator LEDGF interacts with Cdc7-activator of S-phase kinase (ASK) and stimulates its enzymatic activity.
19855849 Integration of HIV-1 DNA is regulated by interplay between viral rev and cellular LEDGF/p75 proteins.
19801648 2009 Affinities between the binding partners of the HIV-1 integrase dimer-lens epithelium-derived growth factor (IN dimer-LEDGF) complex.
19715609 2009 Docetaxel-induced prostate cancer cell death involves concomitant activation of caspase and lysosomal pathways and is attenuated by LEDGF/p75.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
19244240 2009 Lens epithelium-derived growth factor/p75 interacts with the transposase-derived DDE domain of PogZ.
19229293 2009 Structural basis for HIV-1 DNA integration in the human genome, role of the LEDGF/P75 cofactor.
19132083 2009 A novel co-crystal structure affords the design of gain-of-function lentiviral integrase mutants in the presence of modified PSIP1/LEDGF/p75.
18799576 2008 Identification and characterization of PWWP domain residues critical for LEDGF/p75 chromatin binding and human immunodeficiency virus type 1 infectivity.
18708362 2008 Alternative splicing and caspase-mediated cleavage generate antagonistic variants of the stress oncoprotein LEDGF/p75.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18598942 2008 Menin critically links MLL proteins with LEDGF on cancer-associated target genes.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18247352 2008 Insights into the interactions between HIV-1 integrase and human LEDGF/p75 by molecular dynamics simulation and free energy calculation.
18036557 2008 p53 is important for the anti-proliferative effect of ibuprofen in colon carcinoma cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17804545 2007 Antibodies to the lens and cornea in anti-DFS70-positive subjects.
17669426 2007 Differential interaction of HIV-1 integrase and JPO2 with the C terminus of LEDGF/p75.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17451600 2007 LEDGF/p75 has increased expression in blasts from chemotherapy-resistant human acute myelogenic leukemia patients and protects leukemia cells from apoptosis in vitro.
17397262 2007 Virus evolution reveals an exclusive role for LEDGF/p75 in chromosomal tethering of HIV.
17267486 2007 Transcriptional coactivator LEDGF/p75 modulates human immunodeficiency virus type 1 integrase-mediated concerted integration.
17137594 2007 Identification of the LEDGF/p75 binding site in HIV-1 integrase.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16959972 2006 An essential role for LEDGF/p75 in HIV integration.
16793062 2006 Identification and characterization of the chromatin-binding domains of the HIV-1 integrase interactor LEDGF/p75.
16735438 2006 Transcriptional co-activator p75 binds and tethers the Myc-interacting protein JPO2 to chromatin.
16439544 2006 Transient and stable knockdown of the integrase cofactor LEDGF/p75 reveals its role in the replication cycle of human immunodeficiency virus.
16403949 2006 Regulation of heavy subunit chain of gamma-glutamylcysteine synthetase by tumor necrosis factor-alpha in lens epithelial cells: role of LEDGF/p75.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16337983 2006 Biochemical and genetic analyses of integrase-interacting proteins lens epithelium-derived growth factor (LEDGF)/p75 and hepatoma-derived growth factor related protein 2 (HRP2) in preintegration complex function and HIV-1 replication.
16311605 2005 A role for LEDGF/p75 in targeting HIV DNA integration.
16291214 2005 Retroviral DNA integration--mechanism and consequences.
16260736 2005 Structural basis for the recognition between HIV-1 integrase and transcriptional coactivator p75.
16083285 Global phosphoproteome of HT-29 human colon adenocarcinoma cells.
15895093 2005 Solution structure of the HIV-1 integrase-binding domain in LEDGF/p75.
15855167 2005 Integrase mutants defective for interaction with LEDGF/p75 are impaired in chromosome tethering and HIV-1 replication.
15797927 2005 Identification of the LEDGF/p75 HIV-1 integrase-interaction domain and NLS reveals NLS-independent chromatin tethering.
15749713 2005 The interaction of LEDGF/p75 with integrase is lentivirus-specific and promotes DNA binding.
15725483 2005 t(9;11)(p22;p15) with NUP98-LEDGF fusion gene in pediatric acute myeloid leukemia.
15642333 2004 Lens epithelium-derived growth factor (LEDGF/p75) expression in fetal and adult human brain.
15501396 2004 Autoantibodies to DFS70/LEDGF are increased in alopecia areata patients.
15501393 2004 Autoantigenicity of DFS70 is restricted to the conformational epitope of C-terminal alpha-helical domain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15479846 2004 APOBEC3G incorporation into human immunodeficiency virus type 1 particles.
15475359 2004 Lens epithelium-derived growth factor/p75 prevents proteasomal degradation of HIV-1 integrase.
15371438 2004 Identification of an evolutionarily conserved domain in human lens epithelium-derived growth factor/transcriptional co-activator p75 (LEDGF/p75) that binds HIV-1 integrase.
15308744 2004 LEDGF/p75 determines cellular trafficking of diverse lentiviral but not murine oncoretroviral integrase proteins and is a component of functional lentiviral preintegration complexes.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15164053 2004 DNA sequence and analysis of human chromosome 9.
15163664 2004 Identification and characterization of a functional nuclear localization signal in the HIV-1 integrase interactor LEDGF/p75.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12796494 2003 LEDGF/p75 is essential for nuclear and chromosomal targeting of HIV-1 integrase in human cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12407101 2003 HIV-1 integrase forms stable tetramers and associates with LEDGF/p75 protein in human cells.
12228227 2002 Docking of HIV-1 Vpr to the nuclear envelope is mediated by the interaction with the nucleoporin hCG1.
12200376 2002 Identification of tumor-associated antigens in chronic lymphocytic leukemia by SEREX.
12181742 2002 Caspase cleavage of the nuclear autoantigen LEDGF/p75 abrogates its pro-survival function: implications for autoimmunity in atopic disorders.
12126624 2002 Transactivation of involucrin, a marker of differentiation in keratinocytes, by lens epithelium-derived growth factor (LEDGF).
12091904 2002 Charting HIV's remarkable voyage through the cell: Basic science as a passport to future therapy.
11512661 2001 Spatial and temporal dynamics of two alternatively spliced regulatory factors, lens epithelium-derived growth factor (ledgf/p75) and p52, in the nucleus.
10856157 2000 Autoantibodies to DFS 70 kd/transcription coactivator p75 in atopic dermatitis and other conditions.
10721720 2000 Lens epithelium-derived growth factor (LEDGF/p75) and p52 are derived from a single gene by alternative splicing.
10623627 2000 Lens epithelium-derived growth factor: effects on growth and survival of lens epithelial cells, keratinocytes, and fibroblasts.
9885563 1998 A novel transcriptional coactivator, p52, functionally interacts with the essential splicing factor ASF/SF2.
9822615 1998 Isolation of cDNAs encoding novel transcription coactivators p52 and p75 reveals an alternate regulatory mechanism of transcriptional activation.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.