Property Summary

NCBI Gene PubMed Count 15
PubMed Score 10.49
PubTator Score 5.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 6.8e-11
malignant mesothelioma 3232 3.1e-08
osteosarcoma 7950 1.9e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

AA Sequence

MGPLSAPPCTQHITWKGLLLTASLLNFWNPPTTAQVTIEAQPPKVSEGKDVLLLVHNLPQNLTGHIWYKG      1 - 70
QIRDLYHYVTSYIVDGQIIKYGPAYSGRETVYSNASLLIQNVTQEDTGSYTLHIIKRGDGTGGVTGRFTF     71 - 140
TLYLETPKPSISSSNFNPREATEAVILTCDPETPDASYLWWMNGQSLPMTHSLQLSETNRTLYLFGVTNY    141 - 210
TAGPYECEIRNPVSASRSDPVTLNLLPKLPKPYITINNLNPRENKDVSTFTCEPKSENYTYIWWLNGQSL    211 - 280
PVSPRVKRRIENRILILPSVTRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDLPRIYPSFTYYHSGQNL    281 - 350
YLSCFADSNPPAQYSWTINGKFQLSGQKLSIPQITTKHSGLYACSVRNSATGKESSKSVTVRVSDWTLP     351 - 419
//

Text Mined References (15)

PMID Year Title