Property Summary

NCBI Gene PubMed Count 19
PubMed Score 11.16
PubTator Score 7.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 3.300 5.5e-09
cystic fibrosis 2.340 1.2e-06
Breast cancer -1.300 2.1e-02
ovarian cancer -1.100 1.8e-05

 GO Component (1)

 GO Process (1)

Gene RIF (4)

PMID Text
23469002 show that human PSG1 binds alphaIIbbeta3 and inhibits the platelet - fibrinogen interaction. Unexpectedly, however, the KGD is not critical as multiple PSG1 domains independently bind and inhibit alphaIIbbeta3 function
23418492 esults are consistent with a regulatory role of lysine acetylation on PSG expression through a relaxed chromatin state and an increase in the transcriptional activity of Sp1 and KLF6 following an augmented Sp1 acetylation and KLF6 nuclear localization.
17978129 the mRNA expression of PREGNANCY-SPECIFIC BETA-1-GLYCOPROTEIN is up-regulated in cells circulating within blood from women with preeclampsia, and is positively correlated with cliical severity
16563348 Strong synergic activity of KLF4 and Sp1 on the PSG-5 promoter.

AA Sequence

MGPLSAPPCTQHITWKGLLLTASLLNFWNLPITAQVTIEALPPKVSEGKDVLLLVHNLPQNLAGYIWYKG      1 - 70
QLMDLYHYITSYVVDGQINIYGPAYTGRETVYSNASLLIQNVTREDAGSYTLHIIKRGDRTRGVTGYFTF     71 - 140
NLYLKLPKPYITINNSKPRENKDVLAFTCEPKSENYTYIWWLNGQSLPVSPRVKRPIENRILILPSVTRN    141 - 210
ETGPYECEIRDRDGGMRSDPVTLNVLYGPDLPSIYPSFTYYRSGENLYLSCFAESNPPAEYFWTINGKFQ    211 - 280
QSGQKLSIPQITTKHRGLYTCSVRNSATGKESSKSMTVEVSAPSGIGRLPLLNPI                   281 - 335
//

Text Mined References (21)

PMID Year Title
23469002 2013 Pregnancy-specific glycoproteins bind integrin ?IIb?3 and inhibit the platelet-fibrinogen interaction.
23418492 2013 PSG gene expression is up-regulated by lysine acetylation involving histone and nonhistone proteins.
21982860 2012 A secreted protein microarray platform for extracellular protein interaction discovery.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
17978129 2007 Placenta-derived, cellular messenger RNA expression in the maternal blood of preeclamptic women.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16563348 2006 Activation of the human pregnancy-specific glycoprotein PSG-5 promoter by KLF4 and Sp1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
7851895 1994 Gene organization of the pregnancy-specific glycoprotein region on human chromosome 19: assembly and analysis of a 700-kb cosmid contig spanning the region.
7794280 1995 Characterization of cDNA encoding novel pregnancy-specific glycoprotein variants.
2789512 1989 A pregnancy-specific beta 1-glycoprotein, a CEA gene family member, expressed in a human promyelocytic leukemia cell line, HL-60: structures of protein, mRNA and gene.
2735907 1989 Carcinoembryonic antigen gene family: molecular cloning of cDNA for a PS beta G/FL-NCA glycoprotein with a novel domain arrangement.
2537643 1989 Analysis of the size of the carcinoembryonic antigen (CEA) gene family: isolation and sequencing of N-terminal domain exons.
1922019 1991 Characterization of new members of the pregnancy-specific beta 1-glycoprotein family.
1690992 1990 The human pregnancy-specific glycoprotein genes are tightly linked on the long arm of chromosome 19 and are coordinately expressed.
1454058 1992 Nucleotide sequence of a pregnancy-specific beta 1 glycoprotein gene family member. Identification of a functional promoter region and several putative regulatory sequences.