Property Summary

NCBI Gene PubMed Count 16
PubMed Score 9.85
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
malignant mesothelioma 3163 7.4e-09
ovarian cancer 8491 7.5e-08
Atopic dermatitis 944 4.4e-04
cystic fibrosis 1670 7.9e-04
diabetes mellitus 1663 1.0e-03
spina bifida 1064 3.6e-02

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -4.100 7.4e-09
cystic fibrosis 1.011 7.9e-04
Atopic dermatitis -1.300 4.4e-04
diabetes mellitus 1.500 1.0e-03
spina bifida -1.065 3.6e-02
ovarian cancer 1.400 7.5e-08

AA Sequence

MGPLSAPPCTQRITWKGVLLTASLLNFWNPPTTAQVTIEAQPPKVSEGKDVLLLVHNLPQNLAGYIWYKG      1 - 70
QMTYLYHYITSYVVDGQRIIYGPAYSGRERVYSNASLLIQNVTQEDAGSYTLHIIKRRDGTGGVTGHFTF     71 - 140
TLHLETPKPSISSSNLNPREAMEAVILTCDPATPAASYQWWMNGQSLPMTHRLQLSKTNRTLFIFGVTKY    141 - 210
IAGPYECEIRNPVSASRSDPVTLNLLPKLSKPYITINNLNPRENKDVLTFTCEPKSKNYTYIWWLNGQSL    211 - 280
PVSPRVKRPIENRILILPNVTRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDLPSIYPSFTYYRSGENL    281 - 350
YLSCFAESNPRAQYSWTINGKFQLSGQKLSIPQITTKHSGLYACSVRNSATGKESSKSITVKVSDWILP     351 - 419
//

Text Mined References (17)

PMID Year Title
23469002 2013 Pregnancy-specific glycoproteins bind integrin ?IIb?3 and inhibit the platelet-fibrinogen interaction.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
9645429 1998 A single human cell expresses all messenger ribonucleic acids: the arrow of time in a cell.
8003489 1994 Pregnancy-specific glycoprotein gene expression and the induction by 5-bromo-2'-deoxyuridine.
7851896 1994 The pregnancy-specific glycoprotein (PSG) gene cluster on human chromosome 19: fine structure of the 11 PSG genes and identification of 6 new genes forming a third subgroup within the carcinoembryonic antigen (CEA) family.
7851895 1994 Gene organization of the pregnancy-specific glycoprotein region on human chromosome 19: assembly and analysis of a 700-kb cosmid contig spanning the region.
7794280 1995 Characterization of cDNA encoding novel pregnancy-specific glycoprotein variants.
3180995 1988 Characterization of cDNA encoding human pregnancy-specific beta 1-glycoprotein from placenta and extraplacental tissues and their comparison with carcinoembryonic antigen.
2783133 1989 cDNA cloning demonstrates the expression of pregnancy-specific glycoprotein genes, a subgroup of the carcinoembryonic antigen gene family, in fetal liver.
2537643 1989 Analysis of the size of the carcinoembryonic antigen (CEA) gene family: isolation and sequencing of N-terminal domain exons.
2346490 1990 The human pregnancy-specific glycoprotein genes are tightly linked on the long arm of chromosome 19 and are coordinately expressed.
2271648 1990 Characterization of two new members of the pregnancy-specific beta 1-glycoprotein family from the myeloid cell line KG-1 and suggestion of two distinct classes of transcription unit.
1922019 1991 Characterization of new members of the pregnancy-specific beta 1-glycoprotein family.
1690992 1990 The human pregnancy-specific glycoprotein genes are tightly linked on the long arm of chromosome 19 and are coordinately expressed.