Property Summary

NCBI Gene PubMed Count 32
PubMed Score 30.98
PubTator Score 3.58

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -3.200 7.9e-08
osteosarcoma 1.833 6.7e-08
medulloblastoma, large-cell 1.200 5.4e-04
X-linked cerebral adrenoleukodystrophy -1.500 3.3e-02
diabetes mellitus 1.700 1.1e-03
ovarian cancer -1.400 2.8e-06

Synonym

Accession P11464 O75236 P11462 P11463 Q15231 Q15241 Q15243 Q16660 Q6ICR4 Q9P1W5 Q9UQ79 PS-beta-G-1
Symbols SP1
B1G1
PBG1
CD66f
PSBG1
PSG95
PSGGA
DHFRP2
PSBG-1
PSGIIA
FL-NCA-1/2
PS-beta-C/D
PS-beta-G-1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (1)

 GO Process (1)

Gene RIF (5)

PMID Text
21193412 the presence of GAGs on the surface of endothelial cells was required for the ability of PSG1 to induce tube formation
20335639 The aspartic acid at position 95 is not required for PSG1 activity but the amino acids implicated in the formation of a salt bridge within the N-domain are essential.
19911417 first trimester maternal serum marker of small-for-gestational age and preterm delivery
18987160 The differential expression of HLA-E and PSG1 in the sperm of fertile and infertile men is discussed.
12223519 Human PSG1a induces alternative activation in human & mouse monocytes & suppresses the accessory-cell-dependent T-cell proliferation. PSG1a contributes to immunomodulation during pregnancy, with opposite effects on maternal innate & adaptative systems.

AA Sequence

MGTLSAPPCTQRIKWKGLLLTASLLNFWNLPTTAQVTIEAEPTKVSEGKDVLLLVHNLPQNLTGYIWYKG      1 - 70
QMRDLYHYITSYVVDGEIIIYGPAYSGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFTF     71 - 140
TLHLETPKPSISSSNLNPRETMEAVSLTCDPETPDASYLWWMNGQSLPMTHSLKLSETNRTLFLLGVTKY    141 - 210
TAGPYECEIRNPVSASRSDPVTLNLLPKLPKPYITINNLNPRENKDVLNFTCEPKSENYTYIWWLNGQSL    211 - 280
PVSPRVKRPIENRILILPSVTRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDLPRIYPSFTYYRSGEVL    281 - 350
YLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSATGKESSKSMTVEVSDWTVP     351 - 419
//

Text Mined References (32)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21193412 2011 Pregnancy-specific glycoprotein 1 induces endothelial tubulogenesis through interaction with cell surface proteoglycans.
20335639 2010 Human pregnancy specific beta-1-glycoprotein 1 (PSG1) has a potential role in placental vascular morphogenesis.
19911417 2009 First trimester maternal serum pregnancy-specific beta-1-glycoprotein (SP1) as a marker of adverse pregnancy outcome.
18987160 2009 Pregnancy-specific {beta}-1-glycoprotein 1 and human leukocyte antigen-E mRNA in human sperm: differential expression in fertile and infertile men and evidence of a possible functional role during early development.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12223519 2002 Human pregnancy-specific glycoprotein 1a (PSG1a) induces alternative activation in human and mouse monocytes and suppresses the accessory cell-dependent T cell proliferation.
11076863 2000 DNA cloning using in vitro site-specific recombination.
9290143 1997 Highly specific monoclonal antibody demonstrates that pregnancy-specific glycoprotein (PSG) is limited to syncytiotrophoblast in human early and term placenta.
7794280 1995 Characterization of cDNA encoding novel pregnancy-specific glycoprotein variants.
3265688 1988 Molecular cloning of a cDNA for human pregnancy-specific beta 1-glycoprotein:homology with human carcinoembryonic antigen and related proteins.
3260773 1988 The human pregnancy-specific beta 1-glycoprotein (PS beta G) and the carcinoembryonic antigen (CEA)-related proteins are members of the same multigene family.
3257488 1988 Isolation and characterization of complementary DNAs encoding human pregnancy-specific beta 1-glycoprotein.
3180995 1988 Characterization of cDNA encoding human pregnancy-specific beta 1-glycoprotein from placenta and extraplacental tissues and their comparison with carcinoembryonic antigen.
2786492 1989 Pregnancy-specific beta 1-glycoprotein: cDNA cloning, tissue expression, and species specificity of one member of the PS beta G family.
2783133 1989 cDNA cloning demonstrates the expression of pregnancy-specific glycoprotein genes, a subgroup of the carcinoembryonic antigen gene family, in fetal liver.
2735907 1989 Carcinoembryonic antigen gene family: molecular cloning of cDNA for a PS beta G/FL-NCA glycoprotein with a novel domain arrangement.
2541441 1989 Molecular cloning and expression of cDNA for a carcinoembryonic antigen-related fetal liver glycoprotein.
2537643 1989 Analysis of the size of the carcinoembryonic antigen (CEA) gene family: isolation and sequencing of N-terminal domain exons.
2377620 1990 Linkage of two human pregnancy-specific beta 1-glycoprotein genes: one is associated with hydatidiform mole.
2350345 1990 Carcinoembryonic antigen gene family members in submandibular salivary gland: demonstration of pregnancy-specific glycoproteins by cDNA cloning.
2346748 1990 Characterization of cDNAs of the human pregnancy-specific beta 1-glycoprotein family, a new subfamily of the immunoglobulin gene superfamily.
2341148 1990 Structure, evolution and chromosomal localization of the human pregnancy-specific beta 1 glycoprotein gene family.
1572651 1992 The pregnancy-specific glycoprotein family of the immunoglobulin superfamily: identification of new members and estimation of family size.
971765 1976 Pregnancy specific beta1-glycoprotein--a product of the syncytiotrophoblast.