Property Summary

NCBI Gene PubMed Count 18
PubMed Score 15.61
PubTator Score 8.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
malignant mesothelioma -4.300 6.4e-09
astrocytic glioma -2.600 2.9e-03
ependymoma -2.700 1.7e-03
oligodendroglioma -2.300 2.9e-03
psoriasis -1.400 6.7e-05
cutaneous lupus erythematosus -1.200 4.3e-03
glioblastoma -2.900 5.7e-04
osteosarcoma 4.038 2.9e-06
medulloblastoma -3.100 1.0e-03
cystic fibrosis 1.221 1.0e-04
atypical teratoid / rhabdoid tumor -4.500 7.1e-05
medulloblastoma, large-cell -4.300 2.5e-07
primitive neuroectodermal tumor -2.200 1.1e-02
Atopic dermatitis -1.100 1.1e-03
chronic kidney disease 1.300 4.5e-02
non-small cell lung cancer 1.128 1.5e-09
intraductal papillary-mucinous adenoma (... 1.900 8.7e-04
intraductal papillary-mucinous carcinoma... 1.100 4.5e-02
interstitial cystitis -1.100 8.2e-04
adult high grade glioma -2.500 8.5e-06
pilocytic astrocytoma -1.900 8.6e-05
aldosterone-producing adenoma -1.095 1.2e-02
subependymal giant cell astrocytoma -1.729 9.6e-03
lung adenocarcinoma 1.400 4.4e-04
ulcerative colitis -1.600 1.7e-04
ovarian cancer -4.000 2.7e-09
Gaucher disease type 1 -1.600 4.5e-02
chronic rhinosinusitis -1.425 1.5e-02
head and neck cancer -1.400 1.0e-02
head and neck cancer and chronic obstruc... -1.300 4.2e-04

Gene RIF (5)

PMID Text
25296758 EFA6R regulated ARF6 localization and thereby actin stress fiber loss.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20080650 Observational study of gene-disease association. (HuGE Navigator)
18649358 Observational study of gene-disease association. (HuGE Navigator)
16270321 Down regulated in ovarian cancer or absent in ovarian cancer and impact survival.

AA Sequence

MEGRSAAAETFVWVNNASAHSQSVAKAKYEFLFGRSEGKAPDTSDHGGSTLLPPNVTNEFPEYGTMEEGG      1 - 70
EGLRASLEFDGEALPCHPQEQQGVQPLTGCHSGLDSVTEGPKDVREAPSQSHLKEQSLQPIDSLISALKA     71 - 140
TEARIISGTLQATKVLDQDAVSSFSVQQVEKELDTASRKTQRVNKTLPAGQKNLPEIPLSAEVTTEESFY    141 - 210
LSIQKDLTALLTGDTQAEISQIMNNGRKGAVCVQEPSCPLASLGSSAVTCHSAGSVGFLKEQRSALGREH    211 - 280
PGGCDRSSSMGRPGRVKHVEFQGVEILWTGGDKRETQHPIDFETSLQRTASPDSKESSKVPRHLISSAGL    281 - 350
CNSSSLTENVWDESWKAPSERPGTSSGTFSPVRLDESGEDEVFLQENKQHLEKTPKPERDRERISEQEEH    351 - 420
VKGEDEDILGPGYTEDSTDVYSSQFETILDNTSLYYSAESLETLYSEPDSYFSFEMPLTPMIQQRIKEGG    421 - 490
QFLERTSGGGHQDILSVSADGGIVMGYSSGVTNGLNDASDSIYTKGTPEIAFWGSNAGVKTTRLEAHSEM    491 - 560
GSTEILEKETPENLSNGTSSNVEAAKRLAKRLYQLDRFKRSDVAKHLGKNNEFSKLVAEEYLKFFDFTGM    561 - 630
TLDQSLRYFFKAFSLVGETQERERVLIHFSNRYFYCNPDTIASQDGVHCLTCAIMLLNTDLHGHVNIGKK    631 - 700
MTCQEFIANLQGVNEGVDFSKDLLKALYNSIKNEKLEWAVDDEEKKKSPSESTEEKANGTHPKTISRIGS    701 - 770
TTNPFLDIPHDPNAAVYKSGFLARKIHADMDGKKTPRGKRGWKTFYAVLKGTVLYLQKDEYKPEKALSEE    771 - 840
DLKNAVSVHHALASKATDYEKKPNVFKLKTADWRVLLFQTQSPEEMQGWINKINCVAAVFSAPPFPAAIG    841 - 910
SQKKFSRPLLPATTTKLSQEEQLKSHESKLKQITTELAEHRSYPPDKKVKAKDVDEYKLKDHYLEFEKTR    911 - 980
YEMYVSILKEGGKELLSNDESEAAGLKKSHSSPSLNPDTSPITAKVKRNVSERKDHRPETPSIKQKVT      981 - 1048
//

Text Mined References (21)

PMID Year Title
25296758 2014 Exchange factor EFA6R requires C-terminal targeting to the plasma membrane to promote cytoskeletal rearrangement through the activation of ADP-ribosylation factor 6 (ARF6).
24595857 2014 Genome-wide association study of urinary albumin excretion rate in patients with type 1 diabetes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24023788 2013 Gene network analysis in a pediatric cohort identifies novel lung function genes.
23776197 2013 Genome-wide association study identifies ephrin type A receptors implicated in paclitaxel induced peripheral sensory neuropathy.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21507922 2011 Duffy-null-associated low neutrophil counts influence HIV-1 susceptibility in high-risk South African black women.
20736409 2010 Systematic mapping and functional analysis of a family of human epididymal secretory sperm-located proteins.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20080650 2010 Inherited genetic variant predisposes to aggressive but not indolent prostate cancer.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18649358 2008 Replication of a genome-wide case-control study of esophageal squamous cell carcinoma.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16270321 2005 Five genes from chromosomal band 8p22 are significantly down-regulated in ovarian carcinoma: N33 and EFA6R have a potential impact on overall survival.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
12097419 2002 Large scale identification of human hepatocellular carcinoma-associated antigens by autoantibodies.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.