Property Summary

NCBI Gene PubMed Count 113
PubMed Score 274.57
PubTator Score 204.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Bladder Neoplasm 112
Disease Target Count P-value
psoriasis 6694 1.8e-34
Disease Target Count Z-score Confidence
Duodenal ulcer 20 0.0 3.0
Urinary bladder cancer 36 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 4.635 2.3

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.800 1.8e-34

 IMPC Phenotype (1)

Gene RIF (96)

AA Sequence

MKAVLLALLMAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNC      1 - 70
VDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL                      71 - 123
//

Text Mined References (114)

PMID Year Title