Property Summary

NCBI Gene PubMed Count 108
PubMed Score 257.85
PubTator Score 204.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.800 1.8e-34

Gene RIF (92)

PMID Text
26982980 suggest that PSCA is a useful tissue marker for predicting biochemical recurrence in patients with high risk PC receiving NHT and radical prostatectomy
26785734 our data provide a novel molecular mechanism for the tumor suppressor role of PSCA
26554163 Studied six SNP loci: (rs2279115 of BCL2 gene, rs804270 of NEIL2 gene, rs909253 of LTA gene, rs2294008 of PSCA gene, rs3765524 and rs10509670 of PLCE1 gene) to evaluate gastric cancer risk using magnetic nanoparticles and universal tagged arrays.
26527100 analysis of PSCA level in the peripheral blood of PC patients who underwent radical prostatectomy shows it is related to a GADPH reference level (PSCA/GAPDH ratio)
26477693 PSCA has a promoting role in the growth and metastasis of prostate cancer.
26320491 Genetic Variants of PSCA Gene are not Associated with Colorectal Cancer.
26308216 PSCA rs2294008 Polymorphism is associated with Increased Risk of Cancer
26147638 we show that PSCA is a key player in nasopharyngeal carcinoma metastasis
26006239 These results suggest that PSCA gene variation has a potential effect on its expression and gastric adenocarcinoma risk in the Northwest Chinese population.
25964537 PSCA signaling may suppress tumor growth in vivo by modulating immunological characteristics of gallbladder cancer cells.
25727947 These findings imply that the T allele significantly suppresses PSCA expression in vivo by recruiting YY1 to its promoter, which eventually predisposes gastric epithelial cells to GC development
25721731 The PSCA rs2294008 polymorphism is involved in the susceptibility to GC and DU.
25698533 PSCA mRNA is overexpressed in the peripheral blood of prostate cancer patients.
25658482 a significantly increased stomach cancer risk was associated with PSCA SNPs rs2294008 and s2976392 in a Han Chinese population.
25582162 The PSCA rs2294008 C>T polymorphism may be acting through induction of gastric mucosal atrophy, finally leading to development of gastric ulcer and gastric cancer in PSCA rs2294008 T allele carriers with Helicobacter infections.
25503145 PSCA rs2294008 allele A & T was linked with risk of gastric cancer and high-risk gastritis
25374226 rs2294008 polymorphism in the PSCA gene is associated with the risk of bladder cancer.
25117309 the results suggest that the PSCA rs2294008 (C>T) polymorphism is a risk factor for bladder cancer development.
24654646 the T allele of rs2294008, an intronic variant of the PSCA gene at 8q24 that was previously associated with an increased risk of gastric cancer, was inversely associated with a decreased risk of esophageal squamous cell carcinoma.
24557062 In the Han Chinese population, genetic variation in PSCA was significantly correlated with susceptibility to colorectal cancer.
24438073 PSCA-chimeric antigen receptor T cells may be developed for treatment of prostate cancer.
24320701 PSCA is not a marker for a stem cell population nor is it exclusively expressed in the prostate; the function of PSCA in normal cellular processes or carcinogenesis is currently unknown
24308679 Accumulating evidence shows an association of PSCA with cancers, such as prostate, gastric, bladder, and pancreatic cancer; however, its expression varies with different cancer types.
24183365 expression of PSCA as a cell surface marker increased from benign prostate tissues and High Grade Prostatic Intraepithelial Neoplasias to prostate cancer
24146278 Our findings demonstrated that rs2294008 and rs2976392 polymorphism of PSCA is a risk-conferring factor associated with increased gastric cancer susceptibility
24023815 no clearcut interaction with PSCA SNPs in defining risk of gastric precancerous lesions or cancer
23988503 A significant association has been found between the PSCA Trs2294008-Grs2978974 haplotype and higher risk of gallbladder carcinoma in females, whereas this haplotype conferred significantly lower risk to males.
23984394 Overexpression of PSCA and Oct-4 might be closely related to the carcinogenesis, progression, metastasis, or invasive potential and prognosis of gallbladder carcinoma.
23704932 A C-allele of rs2294008 at PSCA increased the risk of gastric ulcer.
23391636 Of the 10 target genes, PCA3 and PSCA mRNAs were significantly differently expressed in cancerous tissue than in histologically benign tissue of cancerous prostates
22938475 findings suggest that the PSCA rs2294008 C>T polymorphism is a risk factor for gastric cancer, especially in diffuse and noncardia gastric cancer and in Chinese
22938426 study suggested rs2294008 in the PSCA gene to be associated with increased risk of gastric cancer and rs2070803 in MUC1 to play a protective role in a Chinese population
22824379 a genotyping study to assess for associations between the PSCA rs2294008 polymorphism and risk of adenomatous polyps and colorectal cancer
22796266 Results indicate the importance of four gastric cancer susceptibility polymorphisms of IL-10, NOC3L, PSCA and MTRR in the Chinese Han population.
22778595 intensity of QDs fluorescence remained stable for two weeks (p = 0.083) after conjugation to the PSCA protein, and nearly 93% of positive expression with their fluorescence still could be seen after four weeks
22536409 Two direct YY1 binding sites within the PSCA promoter, an inhibitory upstream site and a downstream site, proximal to the androgen-responsive element, which stimulated PSCA promoter activity.
22502712 Associations exist between PSCA SNPs and breast cancer susceptibility in Korean women
22481254 Findings suggest that prostate stem cell antigen (PSCA) rs2294008 C > T and rs2976392 G > A polymorphisms may contribute to the susceptibility to gastric cancer, particular in non-cardia or diffused gastric cancer.
22426141 The two loci of PSCA (rs2294008 and rs2976392) were both significantly associated with gastric cancer susceptibility and in linkage disequilibrium.
22416122 A joint effect of two PSCA SNPs, rs2294008 and rs2978974, suggests that both variants may be important for bladder cancer susceptibility.
22387998 The C allele of rs2294008 at PSCA was associated with increased risk of duodenal ulcer in a recessive model but was associated with decreased risk of gastric cancer.
22155405 meta-analysis suggests that PSCA -rs2294008C>T and -rs2976392G>A are potential factors of gastric cancer development for Eastern Asians
21936014 PSCA is acting as a tumor suppressor in GBC development.
21914346 PSCA might play an important role in lymph node metastasis in PSCA might play an important role in lymph node metastasis in the breast. Expression of PSCA was correlated with lymph nodes metastasis.
21748756 Integrin alpha(nu) beta(3), NTRS1 and PSCA mRNA expression increased with tumorigenic potential, but mRNA expression levels for these proteins do not translate directly to equivalent expression levels of membrane bound protein.
21681742 results confirm the association between variation in the promoter region of PSCA and GC risk in Caucasians and also indicate that the rs2294008 variant is a similar risk factor for both the diffuse and intestinal-types of GC.
21600799 Data indicate that PSA, PSMA, hK2, PSCA, DD3, and their combinations, combined analysis of PSA and/or hK2 expression in pelvic lymph nodes could predict biochemical recurrence free survival (BRFS) following radical prostatectomy (RP).
21538581 This study showed that rs2294008 in the PSCA gene was associated with increased risks of gastric cancer in a Korean population, suggests that rs2294008 might play an important role in gastric carcinogenesis.
21503583 prostate stem cell antigen is a novel glioma-associated antigen
21497359 Men with the rs1045531 AA genotype of PSCA were at higher risk for prostate cancer. On haplotype analysis CCCAGGTACGG and CGA haplotype carriers showed a significant association with prostate cancer risk
21429770 Data indicate that RNA silencing of PSCA can inhibit the proliferation and invasiveness properties of prostate cancer PC-3M cells, which may provide a promising therapeutic strategy for prostate cancer.
21268123 Data show that the T allele of PSCA rs2294008 is associated with increased risk of gastric cancer.
21070779 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
21070776 The rs2294008 polymorphism in prostate stem cell antigen increases the risk of noncardia gastric cancer and its precursors in white individuals but protects against proximal cancers.
21070776 Observational study of gene-disease association. (HuGE Navigator)
21064099 Genetic variant in PSCA is associated with diffuse-type gastric cancer.
21064099 Observational study of gene-disease association. (HuGE Navigator)
20955382 prostate stem cell antigen is a marker associated with neoplastic transformation of prostate cells
20507324 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20502058 We report the first analysis of PSCA, PIWIL1, and TBX2 expression in EAC. Our findings suggest that PSCA and TBX2 might be candidate targets for cancer therapy.
20501618 REVIEW: PSCA seems to be a Jekyll and Hyde molecule that plays differential roles, tumor promoting or suppressing, depending on the cellular context.
20374648 Correlation between the level of PSCA expression and tumor growth and suggest a role of PSCA in counteracting the natural immune response.in bladder cancer.
20230293 PSCA gene polymorphisms may be associated with gastric cancer in Tibetans.
20230293 Observational study of gene-disease association. (HuGE Navigator)
20085909 Prostate stem cell antigen is highly expressed in non-small cell lung cancer and may be functionally important for this fatal disease.
20083643 rs2294008 polymorphism of PSCA gene may play a role in bladder cancer carcinogenesis.
20083643 Observational study of gene-disease association. (HuGE Navigator)
19861285 The expression of PSCA can be related to the development of pancreatic cancer, but not to the clinicopathological factors of the tumor.
19822092 Suggest that PSCA is a marker associated with neoplastic transformation of prostate cells, both in cystoprostatectomies with incidental prostate carcinoma and radical prostatectomies.
19648920 Genetic variation in PSCA confers susceptibility to urinary bladder cancer.
19648920 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19582881 Prostate stem cell antigen polymorphisms are associated with stomach cancer.
19554573 Genetic variations in prostate stem cell antigen is associated with gastric cancer.
19554573 Observational study of gene-disease association. (HuGE Navigator)
19462463 This prospective study identifies PSCA mRNA in preoperatively negative prostatic biopsies as a significant predictor of subsequent cancer after TURP.
19343734 Prostate stem cell antigen and prostate-specific membrane antigen are both highly expressed in lymph node and bone metastases of prostate cancer.
19180924 The expressions of PSCA and Claudin-4 are upregulated in the pancreatic carcinomas.
18838214 the expression of PSCA correlates with relevant clinical benchmarks, such as Gleason score and metastasis.
18488030 Genetic variation in PSCA is associated with susceptibility to diffuse-type gastric cancer
18488030 Observational study of gene-disease association. (HuGE Navigator)
18440837 combination of prostate stem cell antigen enhancer and uroplakin II promoter is feasible in constructing bladder cancer-specific vectors
18184265 Overexpression of prostate stem cell antigen (PSCA) is associated with development of gestational trophoblastic neoplasia in hydatidiform mole.
18076024 This prospective study identifies PSCA mRNA in BPH as a significant predictor of cancer development after TURP
17853904 Result shows PSCA contains the cleavage site of the ER signal peptidase and the resulting cleavage products fail to bind to HLA-A(*)0201 and are not recognized by T lymphocytes.
17549363 Increased levels of IgG antibodies against the prostate stem cell antigen in the plasma is associated with pancreatic cancer
17503471 data identify prostate stem cell antigen(PSCA) mRNA in initial prostatic intraepithelial neoplasia (PIN) as a significant predictor of subsequent prostate cancer
17492652 The chimeric alpha-PSCA-beta2/CD3zeta-TCR might now be used for arming human cytotoxic T-cells for further studies towards a clinical treatment of prostate cancer.
16957968 Significantly higher prostate stem cell antigen copy number was associated with pancreatic cancer
15814638 Data suggest that PSCA is a promising tumor marker and potential therapeutic target for patients with metastatic prostate cancer.
12496358 PSCA is expressed in an intermediate subpopulation of PrEC in transition from a basal to a terminally differentiated secretory phenotype
12351697 Here we describe the identification of a compact cell-specific and androgen-responsive enhancer between 2.7 and 3 kb upstream of the transcription start site. The enhancer functions autonomously when positioned immediately adjacent to a minimal promoter.
11752398 This transgenic system helps define the range of cellular changes associated with altered expression of PSCA, shows that transcriptional control is a major component regulating PSCA levels.

AA Sequence

MKAVLLALLMAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNC      1 - 70
VDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL                      71 - 123
//

Text Mined References (109)

PMID Year Title
27098205 2016 Organization, evolution and functions of the human and mouse Ly6/uPAR family genes.
26982980 2016 Prostate Stem Cell Antigen Expression in Radical Prostatectomy Specimens Predicts Early Biochemical Recurrence in Patients with High Risk Prostate Cancer Receiving Neoadjuvant Hormonal Therapy.
26785734 2016 PSCA acts as a tumor suppressor by facilitating the nuclear translocation of RB1CC1 in esophageal squamous cell carcinoma.
26554163 2015 Genetic Variation of BCL2 (rs2279115), NEIL2 (rs804270), LTA (rs909253), PSCA (rs2294008) and PLCE1 (rs3765524, rs10509670) Genes and Their Correlation to Gastric Cancer Risk Based on Universal Tagged Arrays and Fe3O4 Magnetic Nanoparticles.
26527100 2015 The Quantified Level of Circulating Prostate Stem Cell Antigen mRNA relative to GAPDH Level Is a Clinically Significant Indictor for Predicting Biochemical Recurrence in Prostate Cancer Patients after Radical Prostatectomy.
26477693 2016 RNA interference targeting PSCA suppresses primary tumor growth and metastasis formation of human prostate cancer xenografts in SCID mice.
26320491 2015 Common Genetic Variants of PSCA, MUC1 and PLCE1 Genes are not Associated with Colorectal Cancer.
26308216 2015 PSCA rs2294008 Polymorphism with Increased Risk of Cancer.
26147638 2015 Down-regulation of prostate stem cell antigen (PSCA) by Slug promotes metastasis in nasopharyngeal carcinoma.
26006239 2015 The Influence of PSCA Gene Variation on Its Expression and Gastric Adenocarcinoma Susceptibility in the Northwest Chinese Population.
25964537 2015 Down-regulation of Immune-related Genes by PSCA in Gallbladder Cancer Cells Implanted into Mice.
25727947 2015 rs2294008T, a risk allele for gastric and gallbladder cancers, suppresses the PSCA promoter by recruiting the transcription factor YY1.
25721731 2015 Association of PSCA rs2294008 gene variants with poor prognosis and increased susceptibility to gastric cancer and decreased risk of duodenal ulcer disease.
25698533 2015 Prostate stem cell antigen (PSCA) mRNA expression in peripheral blood in patients with benign prostatic hyperplasia and/or prostate cancer.
25658482 2015 Associations of genetic variants in the PSCA, MUC1 and PLCE1 genes with stomach cancer susceptibility in a Chinese population.
25582162 2015 Influence of prostate stem cell antigen gene polymorphisms on susceptibility to Helicobacter pylori-associated diseases: a case-control study.
25503145 2014 PSCA and MUC1 gene polymorphisms are associated with gastric cancer and pre-malignant gastric conditions [corrected].
25374226 2014 Genetic variation in PSCA is associated with bladder cancer susceptibility in a Korean population.
25117309 2014 Prostate stem cell antigen rs2294008 (C>T) polymorphism and bladder cancer risk: a meta-analysis based on cases and controls.
24654646 2014 Genetic variants at 8q24 are associated with risk of esophageal squamous cell carcinoma in a Chinese population.
24557062 2015 Multiple genetic variants are associated with colorectal cancer risk in the Han Chinese population.
24438073 2014 Systemic treatment with CAR-engineered T cells against PSCA delays subcutaneous tumor growth and prolongs survival of mice.
24320701 2014 Prostate stem cell antigen - novel biomarker and therapeutic target?
24308679 2014 Prostate stem cell antigen and cancer risk, mechanisms and therapeutic implications.
24183365 2014 Expression of prostate stem cell antigen (PSCA) in prostate cancer: a tissue microarray study of Iranian patients.
24163127 2014 Genome-wide association study identifies multiple loci associated with bladder cancer risk.
24146278 2014 Quantitative assessment of the influence of prostate stem cell antigen polymorphisms on gastric cancer risk.
24023815 2013 Genetic variation in PSCA and risk of gastric advanced preneoplastic lesions and cancer in relation to Helicobacter pylori infection.
23988503 2013 PSCA gene variants (rs2294008 and rs2978974) confer increased susceptibility of gallbladder carcinoma in females.
23984394 2013 PSCA and Oct-4 expression in the benign and malignant lesions of gallbladder: implication for carcinogenesis, progression, and prognosis of gallbladder adenocarcinoma.
23704932 2013 Impact of PSCA variation on gastric ulcer susceptibility.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23391636 2013 Association of transcript levels of 10 established or candidate-biomarker gene targets with cancerous versus non-cancerous prostate tissue from radical prostatectomy specimens.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22938475 2012 Association of the PSCA rs2294008 C>T polymorphism with gastric cancer risk: evidence from a meta-analysis.
22938426 2012 Case-control study of single nucleotide polymorphisms of PSCA and MUC1 genes with gastric cancer in a Chinese.
22824379 2012 Lack of association between the rs2294008 polymorphism in the prostate stem cell antigen gene and colorectal neoplasia: a case-control and immunohistochemical study.
22796266 2012 Polymorphisms of tumor-related genes IL-10, PSCA, MTRR and NOC3L are associated with the risk of gastric cancer in the Chinese Han population.
22778595 2012 Detection of prostate stem cell antigen expression in human prostate cancer using quantum-dot-based technology.
22536409 2012 Positive and negative regulation of prostate stem cell antigen expression by Yin Yang 1 in prostate epithelial cell lines.
22502712 2012 Prostate stem cell antigen single nucleotide polymorphisms influence risk of estrogen receptor negative breast cancer in Korean females.
22481254 2012 The PSCA polymorphisms derived from genome-wide association study are associated with risk of gastric cancer: a meta-analysis.
22426141 2012 Prostate stem cell antigen polymorphisms and susceptibility to gastric cancer: a systematic review and meta-analysis.
22416122 2012 Common genetic variants in the PSCA gene influence gene expression and bladder cancer risk.
22387998 2012 A genome-wide association study identifies two susceptibility loci for duodenal ulcer in the Japanese population.
22155405 2012 Genetic variations of prostate stem cell antigen (PSCA) contribute to the risk of gastric cancer for Eastern Asians: a meta-analysis based on 16792 individuals.
21936014 2012 Prostate stem cell antigen, a presumable organ-dependent tumor suppressor gene, is down-regulated in gallbladder carcinogenesis.
21914346 2011 [PSCA expression in invasive micropapillary carcinoma of breast].
21748756 2012 Prostate cancer targeting motifs: expression of ?? ?3, neurotensin receptor 1, prostate specific membrane antigen, and prostate stem cell antigen in human prostate cancer cell lines and xenografts.
21681742 2012 Prostate stem-cell antigen gene is associated with diffuse and intestinal gastric cancer in Caucasians: results from the EPIC-EURGAST study.
21600799 2013 Assessment of optimal target genes for detecting micrometastases in pelvic lymph nodes in patients with prostate cancer undergoing radical prostatectomy by real-time reverse transcriptase-polymerase chain reaction.
21538581 2011 Association of a common genetic variant in prostate stem-cell antigen with gastric cancer susceptibility in a Korean population.
21503583 2011 The prostate stem cell antigen represents a novel glioma-associated antigen.
21497359 2011 Haplotype analysis of prostate stem cell antigen and association with prostate cancer risk.
21429770 2013 Small interference RNA-mediated silencing of prostate stem cell antigen attenuates growth, reduces migration and invasion of human prostate cancer PC-3M cells.
21268123 2011 Polymorphisms in prostate stem cell antigen gene rs2294008 increase gastric cancer risk in Chinese.
21070779 2011 A functional single nucleotide polymorphism in mucin 1, at chromosome 1q22, determines susceptibility to diffuse-type gastric cancer.
21070776 2011 Genetic variation in the prostate stem cell antigen gene and upper gastrointestinal cancer in white individuals.
21064099 2011 Genetic variant in PSCA predicts survival of diffuse-type gastric cancer in a Chinese population.
20972438 2010 A multi-stage genome-wide association study of bladder cancer identifies multiple susceptibility loci.
20955382 2010 Expression of prostate stem cell antigen in high-grade prostatic intraepithelial neoplasia and prostate cancer.
20507324 2010 Genome-wide germline analyses on cancer susceptibility and GeMDBJ database: Gastric cancer as an example.
20502058 2010 Expression of PSCA, PIWIL1, and TBX2 in endometrial adenocarcinoma.
20501618 2010 Prostate stem cell antigen: a Jekyll and Hyde molecule?
20374648 2010 Growth delay of human bladder cancer cells by Prostate Stem Cell Antigen downregulation is associated with activation of immune signaling pathways.
20230293 2010 Association and haplotype analysis of prostate stem cell antigen with gastric cancer in Tibetans.
20131315 2010 Genetic variation of PSCA gene is associated with the risk of both diffuse- and intestinal-type gastric cancer in a Chinese population.
20085909 2010 Clinical significance of prostate stem cell antigen expression in non-small cell lung cancer.
20083643 2010 Genetic variation in PSCA and bladder cancer susceptibility in a Chinese population.
20082273 Quantum-dot-based technology for sensitive and stable detection of prostate stem cell antigen expression in human transitional cell carcinoma.
20043108 2010 Primary prostate cancer cultures are models for androgen-independent transit amplifying cells.
20039280 2010 Prostate stem cell antigen mRNA in peripheral blood as a potential predictor of biochemical recurrence in high-risk prostate cancer.
19861285 2009 [Role of prostate stem cell antigen in human pancreatic carcinoma: a tissue microarray-based study].
19822092 Immunohistochemical expression of prostate stem cell antigen in cystoprostatectomies with incidental prostate cancer.
19648920 2009 Genetic variation in the prostate stem cell antigen gene PSCA confers susceptibility to urinary bladder cancer.
19582881 2009 Association of prostate stem cell antigen gene polymorphisms with the risk of stomach cancer in Japanese.
19554573 2009 Two genetic variants in prostate stem cell antigen and gastric cancer susceptibility in a Chinese population.
19462463 2009 Prostate stem cell antigen mRNA expression in preoperatively negative biopsy specimens predicts subsequent cancer after transurethral resection of the prostate for benign prostatic hyperplasia.
19343734 2009 Expression of the gastrin-releasing peptide receptor, the prostate stem cell antigen and the prostate-specific membrane antigen in lymph node and bone metastases of prostate cancer.
19180924 2008 [Expression of prostate stem cell antigen and Claudin-4 in human pancreatic carcinoma].
18838214 2009 Prostate stem cell antigen: a prospective therapeutic and diagnostic target.
18488030 2008 Genetic variation in PSCA is associated with susceptibility to diffuse-type gastric cancer.
18440837 Prostate stem cell antigen enhancer and uroplakin II promoter based bladder cancer targeted tissue-specific vector.
18184265 2008 Overexpression of prostate stem cell antigen is associated with gestational trophoblastic neoplasia.
18076024 2008 The association of prostate stem cell antigen (PSCA) mRNA expression and subsequent prostate cancer risk in men with benign prostatic hyperplasia following transurethral resection of the prostate.
17853904 2007 A novel cytosolic class I antigen-processing pathway for endoplasmic-reticulum-targeted proteins.
17549363 2007 Increased levels of IgG antibodies against peptides of the prostate stem cell antigen in the plasma of pancreatic cancer patients.
17503471 2007 Prostate stem cell antigen (PSCA) mRNA expression in prostatic intraepithelial neoplasia: implications for the development of prostate cancer.
17492652 2007 Targeting of tumor cells expressing the prostate stem cell antigen (PSCA) using genetically engineered T-cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16957968 2006 Utilizing quantitative polymerase chain reaction to evaluate prostate stem cell antigen as a tumor marker in pancreatic cancer.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16341674 2005 Transcriptome analysis of human gastric cancer.
16024997 2005 Prostate stem cell antigen is a putative target for immunotherapy in pancreatic cancer.
16015594 2005 Complete androgen ablation suppresses prostate stem cell antigen (PSCA) mRNA expression in human prostate carcinoma.
15814638 2005 Prostate stem cell antigen is overexpressed in prostate cancer metastases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12496358 2002 Prostate stem cell antigen is a marker of late intermediate prostate epithelial cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12351697 2002 Identification of an androgen-dependent enhancer within the prostate stem cell antigen gene.
11980648 2002 Prostate stem cell antigen as therapy target: tissue expression and in vivo efficacy of an immunoconjugate.
11752398 2002 Growth, regeneration, and tumorigenesis of the prostate activates the PSCA promoter.
11406532 2001 Prostate stem cell antigen is overexpressed in human transitional cell carcinoma.
10973799 2000 Reduced expression of PSCA, a member of the LY-6 family of cell surface antigens, in bladder, esophagus, and stomach tumors.
10713670 2000 Prostate stem cell antigen (PSCA) expression increases with high gleason score, advanced stage and bone metastasis in prostate cancer.
9465086 1998 Prostate stem cell antigen: a cell surface marker overexpressed in prostate cancer.