Property Summary

NCBI Gene PubMed Count 17
PubMed Score 167.36
PubTator Score 94.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 1.0

Expression

  Differential Expression (30)

Disease log2 FC p
gastric cancer 1.700 2.3e-04
hepatocellular carcinoma 1.500 4.4e-06
pancreatic cancer -3.500 4.4e-05
malignant mesothelioma 2.200 1.1e-07
oligodendroglioma 1.500 2.9e-02
osteosarcoma 3.249 3.9e-06
posterior fossa group B ependymoma 2.800 8.9e-11
group 4 medulloblastoma -2.600 1.0e-05
cystic fibrosis -1.221 2.8e-03
atypical teratoid / rhabdoid tumor 1.700 4.3e-03
medulloblastoma, large-cell 1.200 2.7e-03
primary pancreatic ductal adenocarcinoma -3.929 2.1e-06
non-small cell lung cancer 4.333 5.4e-30
intraductal papillary-mucinous adenoma (... -3.800 1.3e-03
X-linked cerebral adrenoleukodystrophy 1.200 4.2e-02
lung cancer 3.000 7.5e-04
colon cancer 2.500 3.1e-04
active Crohn's disease 1.654 4.9e-02
active ulcerative colitis 1.919 3.6e-02
lung adenocarcinoma 1.700 9.8e-12
pilocytic astrocytoma 1.400 2.9e-03
pancreatic carcinoma 2.400 3.5e-03
subependymal giant cell astrocytoma -2.331 1.5e-02
MYELODYSPLASTIC SYNDROME -1.700 3.3e-02
nasopharyngeal carcinoma 1.600 6.8e-03
psoriasis 1.200 1.0e-04
Polycystic Ovary Syndrome -1.818 3.1e-02
lung carcinoma 1.500 3.3e-07
ovarian cancer 4.400 6.3e-08
Down syndrome 1.900 2.7e-04

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (9)

PMID Text
26439504 High expression of PSAT is associated with Colon Cancer.
25152457 phosphoserine aminotransferase deficiency is associated with Neu-Laxova syndrome.
25142862 PSAT1 expression positively correlates with the levels of phosphorylated cyclin D1 in non-small cell lung cancer.
23166591 Expression of HIV-1 Tat upregulates the abundance of phosphoserine aminotransferase 1 (PSAT1) in the nucleoli of Jurkat T-cells
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22190034 Expression of HIV-1 Tat upregulates the abundance of phosphoserine aminotransferase 1 (PSAT1) in the nucleoli of Jurkat T-cells
20955740 we propose an idea that PSAT1 may be implicated in altered serine metabolism and schizophrenia spectrum conditions.
18221502 Overexpression of phosphoserine aminotransferase is associated with colorectal cancer development
12633500 nucleotide sequence and enzymatic activity of two isoforms generated by alternative splicing; differential expression depending upon tissue specificity and cellular proliferation status

AA Sequence

MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNY      1 - 70
KVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTW     71 - 140
NLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVV    141 - 210
IVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYE    211 - 280
IIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVT    281 - 350
IEDVQKLAAFMKKFLEMHQL                                                      351 - 370
//

Text Mined References (22)

PMID Year Title
26439504 2015 Clinical Implication of Serine Metabolism-Associated Enzymes in Colon Cancer.
25152457 2014 Neu-Laxova syndrome is a heterogeneous metabolic disorder caused by defects in enzymes of the L-serine biosynthesis pathway.
25142862 2015 PSAT1 regulates cyclin D1 degradation and sustains proliferation of non-small cell lung cancer cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
21269460 2011 Initial characterization of the human central proteome.
20955740 2011 A novel balanced chromosomal translocation found in subjects with schizophrenia and schizotypal personality disorder: altered l-serine level associated with disruption of PSAT1 gene expression.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18221502 2008 Overexpression of phosphoserine aminotransferase PSAT1 stimulates cell growth and increases chemoresistance of colon cancer cells.
17436247 2007 Phosphoserine aminotransferase deficiency: a novel disorder of the serine biosynthesis pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12633500 2003 Characterization of human phosphoserine aminotransferase involved in the phosphorylated pathway of L-serine biosynthesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10637769 1999 Phosphoserine aminotransferase, the second step-catalyzing enzyme for serine biosynthesis.
3651428 1987 A novel progesterone-induced messenger RNA in rabbit and human endometria. Cloning and sequence analysis of the complementary DNA.