Property Summary

NCBI Gene PubMed Count 29
PubMed Score 11.19
PubTator Score 13.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Alzheimer's disease 644 0.0 1.0
Disease Target Count Z-score Confidence
Leiomyosarcoma 19 3.538 1.8

Expression

  Differential Expression (35)

Disease log2 FC p
malignant mesothelioma -7.200 3.1e-10
astrocytic glioma 1.600 2.3e-02
oligodendroglioma 1.400 1.5e-02
psoriasis -1.600 7.0e-06
posterior fossa group B ependymoma -1.600 3.0e-05
glioblastoma 1.400 1.7e-02
group 4 medulloblastoma -3.900 7.4e-10
atypical teratoid / rhabdoid tumor -2.100 3.9e-04
medulloblastoma, large-cell -3.700 1.4e-05
primitive neuroectodermal tumor -2.500 4.3e-03
Duchenne muscular dystrophy 2.308 4.2e-10
autosomal dominant Emery-Dreifuss muscul... 2.033 4.3e-04
limb girdle muscular dystrophy 2A 2.286 1.3e-07
Becker muscular dystrophy 2.001 3.6e-05
fascioscapulohumeral muscular dystrophy 1.295 1.1e-03
juvenile dermatomyositis 1.204 3.6e-04
Amyotrophic Lateral Sclerosis 1.452 5.3e-05
acute quadriplegic myopathy 2.721 2.3e-08
Atopic dermatitis -1.700 1.6e-04
intraductal papillary-mucinous carcinoma... 2.800 3.3e-02
lung cancer -1.800 6.3e-03
colon cancer -3.400 2.4e-03
diabetes mellitus -2.100 1.1e-02
pilocytic astrocytoma 1.100 3.7e-02
aldosterone-producing adenoma -1.167 3.0e-02
lung adenocarcinoma -1.100 2.7e-04
nasopharyngeal carcinoma -1.100 5.0e-03
lung carcinoma -1.300 6.8e-08
Pick disease -2.200 2.5e-05
progressive supranuclear palsy -1.800 2.4e-02
invasive ductal carcinoma -1.500 3.0e-02
ulcerative colitis 1.200 3.1e-03
ovarian cancer -1.700 3.2e-05
pituitary cancer -2.500 3.1e-06
Down syndrome 1.400 1.5e-03

Gene RIF (15)

PMID Text
26080435 Results show prostate cancer antigen 3 (PCA3) as a dominant-negative oncogene and PRUNE2 protein as an unrecognized tumor suppressor gene in prostate cancer.
25611382 BMCC1 negatively regulates phosphorylation pathway of AKT, resulted in apoptosis and the BNIP2 homology region of BMCC1 interacts with BCL2.
25387265 recurrent germ line and somatic mutations in PRUNE2 were found in parathyroid carcinoma and computationally predicted to be deleterious; in addition, recurrent mutations in kinase genes related to cell migration and invasion were found.
24040105 BMCC1 is an AP-2 associated endosomal protein in prostate cancer cells.
23059019 We showed that Olfaxin, a novel Prune2 isoform contains a BCH motif and localizes predominantly to the synaptic cytosol in the olfactory bulb and layer Ia of the piriform cortex.
22967466 PRUNE2 expression is correlated with the survival of leiomyosarcoma patients. Non-coding RNA PCA3 has a significant positive correlation with PRUNE2 and may play an important role in the pathogenesis of leiomyosarcoma.
21234814 The nerve tissue-specific and post-development expression of PRUNE2/Prune2 suggests that PRUNE2 may contribute to the maintenance of mature nervous systems.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19760627 The androgen regulation of PRUNE2 expression in prostate cancer cells was found to not be of any diagnostic value.
19319183 the longer BMCC1-1 isoform is upregulated in PCa tissues and metastases
18445682 findings show the BNIP2 & BCH domain of BNIPXL interacts with specific conformers of RhoA & mediates association with catalytic DH-PH domains of Lbc, a RhoA-specific guanine nucleotide exchange factor; BNIPXL inhibits Lbc-induced oncogenic transformation
17961507 Our results suggest that the caspase-mediated cleavage of BNIP-2 and BNIP-XL could result in the release of the BCH domain or smaller fragments that are crucial for their proapoptotic activities.
17360660 OBSCN and C9orf65 comprise a highly accurate two-gene classifier for differentiating gastrointestinal stromal tumors and leiomyosarcomas.
16288218 BMCC1 is a new member of prognostic factors for NBL and may play an important role in regulating differentiation, survival and aggressiveness of the tumor cells

AA Sequence

MEEFLQRAKSKLNRSKRLEKVHVVIGPKSCDLDSLISTFTYAYFLDKVSPPGVLCLPVLNIPRTEFNYFT      1 - 70
ETRFILEELNISESFHIFRDEINLHQLNDEGKLSITLVGSSVLASEDKTLESAVVKVINPVEQSDANVEF     71 - 140
RESSSSLVLKEILQEAPELITEQLAHRLRGSILFKWMTMESEKISEKQEEILSILEEKFPNLPPREDIIN    141 - 210
VLQETQFSAQGLSIEQTMLKDLKELSDGEIKVAISTVSMNLENCLFHSNITSDLKAFTDKFGFDVLILFS    211 - 280
SYLSEEQQPRRQIAVYSENMELCSQICCELEECQNPCLELEPFDCGCDEILVYQQEDPSVTCDQVVLVVK    281 - 350
EVINRRCPEMVSNSRTSSTEAVAGSAPLSQGSSGIMELYGSDIEPQPSSVNFIENPPDLNDSNQAQVDAN    351 - 420
VDLVSPDSGLATIRSSRSSKESSVFLSDDSPVGEGAGPHHTLLPGLDSYSPIPEGAVAEEHAWSGEHGEH    421 - 490
FDLFNFDPAPMASGQSQQSSHSADYSPADDFFPNSDLSEGQLPAGPEGLDGMGTNMSNYSSSSLLSGAGK    491 - 560
DSLVEHDEEFVQRQDSPRDNSERNLSLTDFVGDESPSPERLKNTGKRIPPTPMNSLVESSPSTEEPASLY    561 - 630
TEDMTQKATDTGHMGPPQTHARCSSWWGGLEIDSKNIADAWSSSEQESVFQSPESWKEHKPSSIDRRASD    631 - 700
SVFQPKSLEFTKSGPWESEFGQPELGSNDIQDKNEESLPFQNLPMEKSPLPNTSPQGTNHLIEDFASLWH    701 - 770
SGRSPTAMPEPWGNPTDDGEPAAVAPFPAWSAFGKEDHDEALKNTWNLHPTSSKTPSVRDPNEWAMAKSG    771 - 840
FAFSSSELLDNSPSEINNEAAPEIWGKKNNDSRDHIFAPGNPSSDLDHTWTNSKPPKEDQNGLVDPKTRG    841 - 910
KVYEKVDSWNLFEENMKKGGSDVLVPWEDSFLSYKCSDYSASNLGEDSVPSPLDTNYSTSDSYTSPTFAG    911 - 980
DEKETEHKPFAKEEGFESKDGNSTAEETDIPPQSLQQSSRNRISSGPGNLDMWASPHTDNSSEINTTHNL    981 - 1050
DENELKTEHTDGKNISMEDDVGESSQSSYDDPSMMQLYNETNRQLTLLHSSTNSRQTAPDSLDLWNRVIL   1051 - 1120
EDTQSTATISDMDNDLDWDDCSGGAAIPSDGQTEGYMAEGSEPETRFTVRQLEPWGLEYQEANQVDWELP   1121 - 1190
ASDEHTKDSAPSEHHTLNEKSGQLIANSIWDSVMRDKDMSSFMLPGSSHITDSEQRELPPEIPSHSANVK   1191 - 1260
DTHSPDAPAASGTSESEALISHLDKQDTERETLQSDAASLATRLENPGYFPHPDPWKGHGDGQSESEKEA   1261 - 1330
QGATDRGHLDEEEVIASGVENASGISEKGQSDQELSSLVASEHQEICIKSGKISSLAVTFSPQTEEPEEV   1331 - 1400
LEYEEGSYNLDSRDVQTGMSADNLQPKDTHEKHLMSQRNSGETTETSDGMNFTKYVSVPEKDLEKTEECN   1401 - 1470
FLEPENVGGGPPHRVPRSLDFGDVPIDSDVHVSSTCSEITKNLDVKGSENSLPGAGSSGNFDRDTISSEY   1471 - 1540
THSSASSPELNDSSVALSSWGQQPSSGYQEENQGNWSEQNHQESELITTDGQVEIVTKVKDLEKNRINEF   1541 - 1610
EKSFDRKTPTFLEIWNDSVDGDSFSSLSSPETGKYSEHSGTHQESNLIASYQEKNEHDISATVQPEDARV   1611 - 1680
ISTSSGSDDDSVGGEESIEEEIQVANCHVAEDESRAWDSLNESNKFLVTADPKSENIYDYLDSSEPAENE   1681 - 1750
NKSNPFCDNQQSSPDPWTFSPLTETEMQITAVEKEKRSSPETGTTGDVAWQISPKASFPKNEDNSQLEML   1751 - 1820
GFSADSTEWWKASPQEGRLIESPFERELSDSSGVLEINSSVHQNASPWGVPVQGDIEPVETHYTNPFSDN   1821 - 1890
HQSPFLEGNGKNSHEQLWNIQPRQPDPDADKFSQLVKLDQIKEKDSREQTFVSAAGDELTPETPTQEQCQ   1891 - 1960
DTMLPVCDHPDTAFTHAEENSCVTSNVSTNEGQETNQWEQEKSYLGEMTNSSIATENFPAVSSPTQLIMK   1961 - 2030
PGSEWDGSTPSEDSRGTFVPDILHGNFQEGGQLASAAPDLWIDAKKPFSLKADGENPDILTHCEHDSNSQ   2031 - 2100
ASDSPDICHDSEAKQETEKHLSACMGPEVESSELCLTEPEIDEEPIYEPGREFVPSNAELDSENATVLPP   2101 - 2170
IGYQADIKGSSQPASHKGSPEPSEINGDNSTGLQVSEKGASPDMAPILEPVDRRIPRIENVATSIFVTHQ   2171 - 2240
EPTPEGDGSWISDSFSPESQPGARALFDGDPHLSTENPALVPDALLASDTCLDISEAAFDHSFSDASGLN   2241 - 2310
TSTGTIDDMSKLTLSEGHPETPVDGDLGKQDICSSEASWGDFEYDVMGQNIDEDLLREPEHFLYGGDPPL   2311 - 2380
EEDSLKQSLAPYTPPFDLSYLTEPAQSAETIEEAGSPEDESLGCRAAEIVLSALPDRRSEGNQAETKNRL   2381 - 2450
PGSQLAVLHIREDPESVYLPVGAGSNILSPSNVDWEVETDNSDLPAGGDIGPPNGASKEISELEEEKTIP   2451 - 2520
TKEPEQIKSEYKEERCTEKNEDRHALHMDYILVNREENSHSKPETCEERESIAELELYVGSKETGLQGTQ   2521 - 2590
LASFPDTCQPASLNERKGLSAEKMSSKSDTRSSFESPAQDQSWMFLGHSEVGDPSLDARDSGPGWSGKTV   2591 - 2660
EPFSELGLGEGPQLQILEEMKPLESLALEEASGPVSQSQKSKSRGRAGPDAVTLQAVTHDNEWEMLSPQP   2661 - 2730
VQKNMIPDTEMEEETEFLELGTRISRPNGLLSEDVGMDIPFEEGVLSPSAADMRPEPPNSLDLNDTHPRR   2731 - 2800
IKLTAPNINLSLDQSEGSILSDDNLDSPDEIDINVDELDTPDEADSFEYTGHDPTANKDSGQESESIPEY   2801 - 2870
TAEEEREDNRLWRTVVIGEQEQRIDMKVIEPYRRVISHGGYYGDGLNAIIVFAACFLPDSSRADYHYVME   2871 - 2940
NLFLYVISTLELMVAEDYMIVYLNGATPRRRMPGLGWMKKCYQMIDRRLRKNLKSFIIVHPSWFIRTILA   2941 - 3010
VTRPFISSKFSSKIKYVNSLSELSGLIPMDCIHIPESIIKLDEELREASEAAKTSCLYNDPEMSSMEKDI   3011 - 3080
DLKLKEKP                                                                 3081 - 3088
//

Text Mined References (33)

PMID Year Title
26080435 2015 PRUNE2 is a human prostate cancer suppressor regulated by the intronic long noncoding RNA PCA3.
25611382 2015 BMCC1, which is an interacting partner of BCL2, attenuates AKT activity, accompanied by apoptosis.
25392181 2015 Identification and diagnostic performance of a small RNA within the PCA3 and BMCC1 gene locus that potentially targets mRNA.
25387265 2015 Whole-exome sequencing studies of parathyroid carcinomas reveal novel PRUNE2 mutations, distinctive mutational spectra related to APOBEC-catalyzed DNA mutagenesis and mutational enrichment in kinases associated with cell migration and invasion.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24040105 2013 BMCC1 is an AP-2 associated endosomal protein in prostate cancer cells.
23246912 2013 Bmcc1s interacts with the phosphate-activated glutaminase in the brain.
23059019 2012 Olfaxin as a novel Prune2 isoform predominantly expressed in olfactory system.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
22967466 2012 [Expression of PRUNE2 mRNA and its positive correlation with non-coding RNA PCA3 in leiomyosarcoma].
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22523599 2012 Bmcc1s, a novel brain-isoform of Bmcc1, affects cell morphology by regulating MAP6/STOP functions.
21234814 2011 Cancer-related PRUNE2 protein is associated with nucleotides and is highly expressed in mature nerve tissues.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19760627 2010 Differential expression of PCA3 and its overlapping PRUNE2 transcript in prostate cancer.
19668339 2009 Hippocampal atrophy as a quantitative trait in a genome-wide association study identifying novel susceptibility genes for Alzheimer's disease.
19319183 2009 New genomic structure for prostate cancer specific gene PCA3 within BMCC1: implications for prostate cancer detection and progression.
18445682 2008 BNIP2 extra long inhibits RhoA and cellular transformation by Lbc RhoGEF via its BCH domain.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17961507 2007 Cleavage of BNIP-2 and BNIP-XL by caspases.
17360660 2007 Highly accurate two-gene classifier for differentiating gastrointestinal stromal tumors and leiomyosarcomas.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16288218 2006 Increased expression of proapoptotic BMCC1, a novel gene with the BNIP2 and Cdc42GAP homology (BCH) domain, is associated with favorable prognosis in human neuroblastomas.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11181995 2001 The sequence of the human genome.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.