Property Summary

NCBI Gene PubMed Count 20
PubMed Score 22.54
PubTator Score 3.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.300 1.5e-06
osteosarcoma 2.614 7.9e-07
group 3 medulloblastoma 1.700 2.0e-03
medulloblastoma, large-cell 1.300 4.4e-06
intraductal papillary-mucinous adenoma (... 1.100 6.3e-03
acute myeloid leukemia -1.600 4.1e-02
ovarian cancer 1.400 5.3e-04
dermatomyositis 1.400 1.8e-04

Gene RIF (7)

PMID Text
25026278 Authors assessed h-Prune levels in peripheral blood of lung cancer patients using ELISA assay, showing that h-Prune is an early diagnostic marker for lung cancer.
23448979 Data indicate that the D388A and D422A mutant h-Prune proteins interact weakly with Nm23-H1.
20735841 Increased amplification of PRUNE is associated with T4 breast carcinoma.
18978678 Observational study of gene-disease association. (HuGE Navigator)
17655525 Prune is composed of two independent active sites and two interaction sites for the assembly of oligomeric signalling complexes
16428445 GSK-3 and h-prune cooperatively regulate the disassembly of focal adhesions to promote cell migration and that h-prune is useful as a marker for tumor aggressiveness.
15671547 prune has a role in breast neoplasm aggressiveness

AA Sequence

MEDYLQGCRAALQESRPLHVVLGNEACDLDSTVSALALAFYLAKTTEAEEVFVPVLNIKRSELPLRGDIV      1 - 70
FFLQKVHIPESILIFRDEIDLHALYQAGQLTLILVDHHILSKSDTALEEAVAEVLDHRPIEPKHCPPCHV     71 - 140
SVELVGSCATLVTERILQGAPEILDRQTAALLHGTIILDCVNMDLKIGKATPKDSKYVEKLEALFPDLPK    141 - 210
RNDIFDSLQKAKFDVSGLTTEQMLRKDQKTIYRQGVKVAISAIYMDLEAFLQRSNLLADLHAFCQAHSYD    211 - 280
VLVAMTIFFNTHNEPVRQLAIFCPHVALQTTICEVLERSHSPPLKLTPASSTHPNLHAYLQGNTQVSRKK    281 - 350
LLPLLQEALSAYFDSMKIPSGQPETADVSREQVDKELDRASNSLISGLSQDEEDPPLPPTPMNSLVDECP    351 - 420
LDQGLPKLSAEAVFEKCSQISLSQSTTASLSKK                                         421 - 453
//

Text Mined References (28)

PMID Year Title
25138575 2015 A therapeutic approach to treat prostate cancer by targeting Nm23-H1/h-Prune interaction.
25026278 2014 H-Prune through GSK-3? interaction sustains canonical WNT/?-catenin signaling enhancing cancer progression in NSCLC.
23939913 2013 Mapping functional interaction sites of human prune C-terminal domain by NMR spectroscopy in human cell lysates.
23901273 2013 gH625 is a viral derived peptide for effective delivery of intrinsically disordered proteins.
23585552 2013 Genome-wide association study identifies genetic risk underlying primary rhegmatogenous retinal detachment.
23448979 2013 Neuroblastoma tumorigenesis is regulated through the Nm23-H1/h-Prune C-terminal interaction.
23059542 2012 Novel pyrimidopyrimidine derivatives for inhibition of cellular proliferation and motility induced by h-prune in breast cancer.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20735841 2010 Molecular alterations in key-regulator genes among patients with T4 breast carcinoma.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
20154719 2010 ASAP1 promotes tumor cell motility and invasiveness, stimulates metastasis formation in vivo, and correlates with poor survival in colorectal cancer patients.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
18700747 2008 Human metastasis regulator protein H-prune is a short-chain exopolyphosphatase.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17906697 2008 Phosphorylation of nm23-H1 by CKI induces its complex formation with h-prune and promotes cell motility.
17655525 2007 Domain mapping on the human metastasis regulator protein h-Prune reveals a C-terminal dimerization domain.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16428445 2006 Glycogen synthase kinase 3 and h-prune regulate cell migration by modulating focal adhesions.
15671547 2005 Overexpression of h-prune in breast cancer is correlated with advanced disease status.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14998490 2004 Prune cAMP phosphodiesterase binds nm23-H1 and promotes cancer metastasis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11687967 2001 Amplification and overexpression of PRUNE in human sarcomas and breast carcinomas-a possible mechanism for altering the nm23-H1 activity.
10602478 1999 Evidence for interaction between human PRUNE and nm23-H1 NDPKinase.
10524757 1998 Sequencing analysis of forty-eight human image cDNA clones similar to Drosophila mutant protein.