Property Summary

Ligand Count 12
NCBI Gene PubMed Count 137
PubMed Score 2968.78
PubTator Score 1796.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Acute Lung Injury 22
Disease Target Count P-value
osteosarcoma 7950 4.7e-13
Disease Target Count
Wegener Granulomatosis 4

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -7.204 4.7e-13

Protein-protein Interaction (11)

Gene RIF (99)

AA Sequence

MAHRPPSPALASVLLALLLSGAARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAA      1 - 70
HCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLP     71 - 140
QQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICD    141 - 210
GIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRRVEAKGRP                            211 - 256
//

Text Mined References (142)

PMID Year Title