Property Summary

Ligand Count 16
NCBI Gene PubMed Count 59
PubMed Score 112.97
PubTator Score 91.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
breast carcinoma 1.100 6.2e-03
ductal carcinoma in situ 2.800 1.5e-03
invasive ductal carcinoma 3.100 5.5e-03
lung adenocarcinoma 1.066 2.7e-03
lung carcinoma -2.400 1.6e-27
pituitary cancer -1.100 2.6e-04
primary Sjogren syndrome -1.100 3.5e-02
psoriasis 1.200 1.1e-03
spina bifida -2.103 4.6e-02

Gene RIF (44)

AA Sequence

MAQKGVLGPGQLGAVAILLYLGLLRSGTGAEGAEAPCGVAPQARITGGSSAVAGQWPWQVSITYEGVHVC      1 - 70
GGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQL     71 - 140
SRPITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAK    141 - 210
PEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASW    211 - 280
IQSKVTELQPRVVPQTQESQPDSNLCGSHLAFSSAPAQGLLRPILFLPLGLALGLLSPWLSEH           281 - 343
//

Text Mined References (61)

PMID Year Title