Property Summary

NCBI Gene PubMed Count 55
PubMed Score 104.38
PubTator Score 91.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis 1.200 1.1e-03
breast carcinoma 1.100 6.2e-03
primary Sjogren syndrome -1.100 3.5e-02
lung adenocarcinoma 1.066 2.7e-03
lung carcinoma -2.400 1.6e-27
spina bifida -2.103 4.6e-02
ductal carcinoma in situ 2.800 1.5e-03
invasive ductal carcinoma 3.100 5.5e-03
pituitary cancer -1.100 2.6e-04

Protein-protein Interaction (1)

Gene RIF (40)

PMID Text
27036110 Overexpression of PRSS8 mRNA and high levels of prostasin in multiple subtypes of early stage ovarian tumors may provide clinical biomarkers for early detection of ovarian cancer.
26867056 It is concluded that prostasin protein level change is less likely to be causally involved in placental dysfunction in preeclampsia.
26252104 Polymorphism of the prostasin gene is closely associated with poor pregnancy outcomes of early-onset severe preeclampsia.
25931204 In urinary exosomes, NCC and prostasin had a diurnal pattern parallel to ADH and aquaporin 2, confirming that, in healthy subjects, both prostasin and NCC relate to water balance.
25188517 Prostasin regulate the Lin28/Let-7 loop in ovarian cancer cells.
24890150 The higher frequency of C allele of prostasin gene at rs12597511 is associated with severe preeclampsia.
24434518 Prostasin repress cancer cells and contribute to chemoresistance by modulating the CASP/PAK2-p34/actin pathway.
23707658 Our study suggested that Axl and prostasin expression may be closely related to carcinogenesis, metastasis, and prognosis of ovarian adenocarcinoma.
23673661 prostasin is a non-enzymatic co-factor for matriptase activation
23443662 Prostasin requires expression of endogenous matriptase to stimulate barrier formation since matriptase depletion by siRNA silencing abrogates prostasin barrier-forming activity.
23344129 urinary prostasin correlates with the aldosterone to renin ratio, and it is physiologically modulated by natriuresis in normotensive individuals
22582115 prostasin is present, mature and active on the apical surface of wild-type and cystic fibrosis bronchial epithelial cells
21933610 Study does not provide evidence of a major role of prostasin variation in blood pressure modulation.
21678412 Expression of matriptase and prostasin is closely correlated in breast cancer cell lines and in breast cancer tissues. Matriptase and prostasin display a near identical spatial expression pattern in the epithelial compartment of breast cancer tissue.
21148558 Transport via the transcytotic pathway makes prostasin available as a substrate for matriptase.
20696767 the matriptase-prostasin proteolytic cascade is tightly regulated by two mechanisms: 1) prostasin activation temporally coupled to matriptase autoactivation and 2) HAI-1 rapidly inhibiting not only active matriptase but also active prostasin
20204133 Luciferase assay using CYP11B2 promoter revealed that prostasin significantly increased the transcriptional activity of CYP11B2.
20089521 Prostasin may regulate trophoblast cell proliferation via modulating the EGFR-MAPK signaling pathway.
20078940 Essential hypertension in Xinjiang Kazakhs is not associated with the 2827C>T polymorphism in the prostasin gene.
20078940 Observational study of gene-disease association. (HuGE Navigator)
19911255 Hepsin activates prostasin and cleaves the extracellular domain of the epidermal growth factor receptor.
19849847 Loss of prostasin expression in bladder transitional cell carcinomas is associated with epithelial-mesenchymal transition.
19847458 In the in vitro cultured human choriocarcinomal JEG-3 cells, treatment with functional antibody against prostasin led to promotion in cell invasion capability, as well as increase in the production of MMP-2, MMP-26, TIMP-1, and TIMP-4.
19606239 prostasin is overexpressed in many epithelial ovarian cancers; a potential tumor marker
19555470 the mRNA level of PN-1 is significantly elevated in colorectal cancer tissue
19388054 study presents structures of the extracellular domain of active prostasin in several forms; of particular interest is the S1 subsite loop which opens and closes in response to basic residues or divalent ions, directly binding Ca(+2) cations
19262497 it is not clear, at the present time, whether endogenous aldosterone regulates prostasin expression or vice versa
19127211 Suggest that urinary prostasin could be a novel biomarker and/or mechanism for renal pressure natriuresis in normotensive black adolescents.
18922802 crystallographic analysis of prostasin
18583984 Genetic variation of the prostasin gene may be implicated in the development of hypertension in youths.
18583984 Observational study of gene-disease association. (HuGE Navigator)
18310226 prostasin, an upstream prostasin-activating protease, and PN-1 regulate Na+ absorption in the airway and that abnormal prostasin expression contributes to excessive proteolytic activation of ENaC in cystic fibrosis patients
17940283 reduced activity of a matriptase-prostasin proteolytic cascade is the etiological origin of human ARIH and provides an important mouse model for the exploration of matriptase function in ARIH
17532063 Data show that prostasin induces protease-dependent and independent molecular changes in the human prostate carcinoma cell line PC-3.
17145811 The PRSS8 gene was shown to effectively separate these two tumor(chromophobe renal cell carcinoma (RCC) and benign oncocytoma) groups by quantitative reverse transcription-PCR using fresh tissue samples, with similar trends seen on formalin-fixed tissues.
16541421 Dihydrotestosterone regulates prostasin expression in prostate cells via sterol-regulatory element-binding protein stimulation and SLUG repression of prostasin promoter
16103126 HAI-1B is a potential physiological regulator of prostasin function
15474520 prostasin is a channel activating protease; analysis of its substrate specificity
15246975 prostasin is a major regulator of ENaC-mediated Na+ current in DeltaF508 cystic fibrosis epithelia
11756432 protease-mediated regulation of sodium absorption is a function of human airway epithelia, and prostasin is a likely candidate for this activity.

AA Sequence

MAQKGVLGPGQLGAVAILLYLGLLRSGTGAEGAEAPCGVAPQARITGGSSAVAGQWPWQVSITYEGVHVC      1 - 70
GGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQL     71 - 140
SRPITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAK    141 - 210
PEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASW    211 - 280
IQSKVTELQPRVVPQTQESQPDSNLCGSHLAFSSAPAQGLLRPILFLPLGLALGLLSPWLSEH           281 - 343
//

Text Mined References (57)

PMID Year Title
27036110 2016 The serine protease prostasin (PRSS8) is a potential biomarker for early detection of ovarian cancer.
26867056 2016 Prostasin and matriptase (ST14) in placenta from preeclamptic and healthy pregnant women.
26317012 2013 Prostasin: An Epithelial Sodium Channel Regulator.
26252104 2015 [Association of prostasin gene rs12597511 polymorphism with outcomes of pregnancy with severe preeclampsia].
25931204 2015 Circadian exosomal expression of renal thiazide-sensitive NaCl cotransporter (NCC) and prostasin in healthy individuals.
25188517 2014 PSP94, an upstream signaling mediator of prostasin found highly elevated in ovarian cancer.
24890150 2014 Prostasin gene polymorphism at rs12597511 is associated with severe preeclampsia in Chinese Han women.
24434518 2014 Prostasin may contribute to chemoresistance, repress cancer cells in ovarian cancer, and is involved in the signaling pathways of CASP/PAK2-p34/actin.
23707658 2013 Axl and prostasin are biomarkers for prognosis of ovarian adenocarcinoma.
23673661 2013 A matriptase-prostasin reciprocal zymogen activation complex with unique features: prostasin as a non-enzymatic co-factor for matriptase activation.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23443662 2013 Prostasin is required for matriptase activation in intestinal epithelial cells to regulate closure of the paracellular pathway.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23344129 2013 Urinary prostasin in normotensive individuals: correlation with the aldosterone to renin ratio and urinary sodium.
22582115 2012 Activity and inhibition of prostasin and matriptase on apical and basolateral surfaces of human airway epithelial cells.
21933610 2011 Association of genetic variations of the prostasin gene with essential hypertension in the Xinjiang Kazakh population.
21678412 2012 Strong expression association between matriptase and its substrate prostasin in breast cancer.
21148558 2011 Transport via the transcytotic pathway makes prostasin available as a substrate for matriptase.
20696767 2010 Regulation of the matriptase-prostasin cell surface proteolytic cascade by hepatocyte growth factor activator inhibitor-1 during epidermal differentiation.
20204133 2010 Regulation of adrenal aldosterone production by serine protease prostasin.
20089521 2010 Prostasin regulates human placental trophoblast cell proliferation via the epidermal growth factor receptor signaling pathway.
20078940 2009 [Association of genetic variations of prostasin gene with the essential hypertension in Xinjiang Kazakhs].
19911255 2010 Hepsin activates prostasin and cleaves the extracellular domain of the epidermal growth factor receptor.
19849847 2009 Loss of prostasin (PRSS8) in human bladder transitional cell carcinoma cell lines is associated with epithelial-mesenchymal transition (EMT).
19847458 2009 Prostasin inhibits cell invasion in human choriocarcinomal JEG-3 cells.
19606239 2009 Prostasin, a potential tumor marker in ovarian cancer--a pilot study.
19555470 2009 Expression of prostasin and its inhibitors during colorectal cancer carcinogenesis.
19388054 2009 Active site conformational changes of prostasin provide a new mechanism of protease regulation by divalent cations.
19262497 2009 Urinary prostasin in humans: relationships among prostasin, aldosterone and epithelial sodium channel activity.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19127211 2009 Urinary prostasin: a possible biomarker for renal pressure natriuresis in black adolescents.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18922802 2008 Structure of human prostasin, a target for the regulation of hypertension.
18583984 2008 Prostasin: a possible candidate gene for human hypertension.
18310226 2008 Prostasin expression is regulated by airway surface liquid volume and is increased in cystic fibrosis.
17940283 2007 Autosomal ichthyosis with hypotrichosis syndrome displays low matriptase proteolytic activity and is phenocopied in ST14 hypomorphic mice.
17532063 2007 Prostasin induces protease-dependent and independent molecular changes in the human prostate carcinoma cell line PC-3.
17145811 2006 Gene expression profiling separates chromophobe renal cell carcinoma from oncocytoma and identifies vesicular transport and cell junction proteins as differentially expressed genes.
16541421 2006 Androgen regulation of prostasin gene expression is mediated by sterol-regulatory element-binding proteins and SLUG.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16103126 2005 Identification of hepatocyte growth factor activator inhibitor-1B as a potential physiological inhibitor of prostasin.
16061697 2005 The epidermal barrier function is dependent on the serine protease CAP1/Prss8.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15474520 2004 Biochemical characterization of prostasin, a channel activating protease.
15246975 2004 Prostasin, a membrane-anchored serine peptidase, regulates sodium currents in JME/CF15 cells, a cystic fibrosis airway epithelial cell line.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12626364 2003 Adenovirus-mediated human prostasin gene delivery is linked to increased aldosterone production and hypertension in rats.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11756432 2002 Regulation of the epithelial sodium channel by serine proteases in human airways.
11274175 2001 Prostasin is a glycosylphosphatidylinositol-anchored active serine protease.
10077646 1999 Molecular cloning and characterization of prostase, an androgen-regulated serine protease with prostate-restricted expression.
8838796 1996 Structure and chromosomal localization of the human prostasin (PRSS8) gene.
8034638 1994 Prostasin is a novel human serine proteinase from seminal fluid. Purification, tissue distribution, and localization in prostate gland.
7768952 1995 Molecular cloning, tissue-specific expression, and cellular localization of human prostasin mRNA.