Property Summary

NCBI Gene PubMed Count 6
PubMed Score 71.90

Knowledge Summary


No data available


  Disease (1)

AA Sequence

FADGCVLRADVGIYAKIFYYIPWIENVIQNN                                           211 - 241

Text Mined References (7)

PMID Year Title
16751668 2006 Scan of human genome reveals no new Loci under ancient balancing selection.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8650574 1996 The complete 685-kilobase DNA sequence of the human beta T cell receptor locus.