Property Summary

NCBI Gene PubMed Count 6
PubMed Score 73.67

Knowledge Summary


No data available


  Disease (1)

AA Sequence

FADGCVLRADVGIYAKIFYYIPWIENVIQNN                                           211 - 241

Text Mined References (7)

PMID Year Title