Property Summary

NCBI Gene PubMed Count 10
PubMed Score 292.32
PubTator Score 303.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... -1.051 1.3e-02

 GO Process (1)

Gene RIF (2)

PMID Text
25156428 Structural insights in to substrate recognition by the trypsin-fold protease NSP4.
23904161 cathepsin C was identified as the activator of NSP4 in vivo, as cathepsin C deficiency resulted in a complete absence of NSP4 in a Papillon-Lefevre patient

AA Sequence

MGLGLRGWGRPLLTVATALMLPVKPPAGSWGAQIIGGHEVTPHSRPYMASVRFGGQHHCGGFLLRARWVV      1 - 70
SAAHCFSHRDLRTGLVVLGAHVLSTAEPTQQVFGIDALTTHPDYHPMTHANDICLLRLNGSAVLGPAVGL     71 - 140
LRPPGRRARPPTAGTRCRVAGWGFVSDFEELPPGLMEAKVRVLDPDVCNSSWKGHLTLTMLCTRSGDSHR    141 - 210
RGFCSADSGGPLVCRNRAHGLVSFSGLWCGDPKTPDVYTQVSAFVAWIWDVVRRSSPQPGPLPGTTRPPG    211 - 280
EAA                                                                       281 - 283
//

Text Mined References (12)

PMID Year Title
26955973 2016 PEGylated substrates of NSP4 protease: A tool to study protease specificity.
26172376 2015 Design of a Selective Substrate and Activity Based Probe for Human Neutrophil Serine Protease 4.
25156428 2014 Structures of neutrophil serine protease 4 reveal an unusual mechanism of substrate recognition by a trypsin-fold protease.
23904161 2013 NSP4 is stored in azurophil granules and released by activated neutrophils as active endoprotease with restricted specificity.
22474388 2012 NSP4, an elastase-related protease in human neutrophils with arginine specificity.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9533035 1997 Assignment of protease, serine-like 1 (PRSSL1) to human chromosome 19q13 by in situ hybridization and radiation hybrid mapping.
8586417 1995 Monitoring cell physiology by expression profiles and discovering cell type-specific genes by compiled expression profiles.