Property Summary

NCBI Gene PubMed Count 13
PubMed Score 41.35
PubTator Score 11.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (12)

Disease log2 FC p
Astrocytoma, Pilocytic -1.300 6.1e-06
Breast cancer -1.700 4.5e-05
glioblastoma -1.100 6.5e-05
group 3 medulloblastoma -1.600 1.9e-03
interstitial cystitis -1.400 2.1e-02
lung cancer -1.300 1.5e-02
medulloblastoma, large-cell -1.300 4.6e-03
osteosarcoma -1.407 3.0e-03
pediatric high grade glioma -1.100 8.7e-05
primary pancreatic ductal adenocarcinoma -1.302 2.8e-03
primitive neuroectodermal tumor -1.500 1.5e-03
psoriasis -1.700 1.8e-04

Gene RIF (8)

AA Sequence

MAVWLAQWLGPLLLVSLWGLLAPASLLRRLGEHIQQFQESSAQGLGLSLGPGAAALPKVGWLEQLLDPFN      1 - 70
VSDRRSFLQRYWVNDQHWVGQDGPIFLHLGGEGSLGPGSVMRGHPAALAPAWGALVISLEHRFYGLSIPA     71 - 140
GGLEMAQLRFLSSRLALADVVSARLALSRLFNISSSSPWICFGGSYAGSLAAWARLKFPHLIFASVASSA    141 - 210
PVRAVLDFSEYNDVVSRSLMSTAIGGSLECRAAVSVAFAEVERRLRSGGAAQAALRTELSACGPLGRAEN    211 - 280
QAELLGALQALVGGVVQYDGQTGAPLSVRQLCGLLLGGGGNRSHSTPYCGLRRAVQIVLHSLGQKCLSFS    281 - 350
RAETVAQLRSTEPQLSGVGDRQWLYQTCTEFGFYVTCENPRCPFSQLPALPSQLDLCEQVFGLSALSVAQ    351 - 420
AVAQTNSYYGGQTPGANKVLFVNGDTDPWHVLSVTQALGSSESTLLIRTGSHCLDMAPERPSDSPSLRLG    421 - 490
RQNIFQQLQTWLKLAKESQIKGEV                                                  491 - 514
//

Text Mined References (13)

PMID Year Title