Property Summary

NCBI Gene PubMed Count 7
PubMed Score 30.55
PubTator Score 12.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Atopic dermatitis -1.100 4.2e-03
atypical teratoid / rhabdoid tumor 1.600 5.7e-03
cutaneous lupus erythematosus -1.300 2.0e-02
group 3 medulloblastoma 1.700 1.2e-02
intraductal papillary-mucinous neoplasm ... 1.800 1.3e-03
lung carcinoma -1.500 2.4e-10
malignant mesothelioma -2.500 1.3e-07
medulloblastoma, large-cell 1.600 3.0e-02
urothelial carcinoma -1.500 8.2e-07

Gene RIF (2)

AA Sequence

MTLARFVLALMLGALPEVVGFDSVLNDSLHHSHRHSPPAGPHYPYYLPTQQRPPRTRPPPPLPRFPRPPR      1 - 70
ALPAQRPHALQAGHTPRPHPWGCPAGEPWVSVTDFGAPCLRWAEVPPFLERSPPASWAQLRGQRHNFCRS     71 - 140
PDGAGRPWCFYGDARGKVDWGYCDCRHGSVRLRGGKNEFEGTVEVYASGVWGTVCSSHWDDSDASVICHQ    141 - 210
LQLGGKGIAKQTPFSGLGLIPIYWSNVRCRGDEENILLCEKDIWQGGVCPQKMAAAVTCSFSHGPTFPII    211 - 280
RLAGGSSVHEGRVELYHAGQWGTVCDDQWDDADAEVICRQLGLSGIAKAWHQAYFGEGSGPVMLDEVRCT    281 - 350
GNELSIEQCPKSSWGEHNCGHKEDAGVSCTPLTDGVIRLAGGKGSHEGRLEVYYRGQWGTVCDDGWTELN    351 - 420
TYVVCRQLGFKYGKQASANHFEESTGPIWLDDVSCSGKETRFLQCSRRQWGRHDCSHREDVSIACYPGGE    421 - 490
GHRLSLGFPVRLMDGENKKEGRVEVFINGQWGTICDDGWTDKDAAVICRQLGYKGPARARTMAYFGEGKG    491 - 560
PIHVDNVKCTGNERSLADCIKQDIGRHNCRHSEDAGVICDYFGKKASGNSNKESLSSVCGLRLLHRRQKR    561 - 630
IIGGKNSLRGGWPWQVSLRLKSSHGDGRLLCGATLLSSCWVLTAAHCFKRYGNSTRSYAVRVGDYHTLVP    631 - 700
EEFEEEIGVQQIVIHREYRPDRSDYDIALVRLQGPEEQCARFSSHVLPACLPLWRERPQKTASNCYITGW    701 - 770
GDTGRAYSRTLQQAAIPLLPKRFCEERYKGRFTGRMLCAGNLHEHKRVDSCQGDSGGPLMCERPGESWVV    771 - 840
YGVTSWGYGCGVKDSPGVYTKVSAFVPWIKSVTKL                                       841 - 875
//

Text Mined References (8)

PMID Year Title