Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.56
PubTator Score 17.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
facioscapulohumeral dystrophy 2.000 4.8e-02
glioblastoma 1.100 5.7e-03
lung adenocarcinoma 1.700 1.7e-04
malignant mesothelioma 1.200 1.0e-04
non primary Sjogren syndrome sicca 1.200 1.8e-02
osteosarcoma 2.321 1.2e-04
psoriasis 1.300 1.3e-03

Gene RIF (5)

AA Sequence

MDSAAAAFALDKPALGPGPPPPPPALGPGDCAQARKNFSVSHLLDLEEVAAAGRLAARPGARAEAREGAA      1 - 70
REPSGGSSGSEAAPQDGECPSPGRGSAAKRKKKQRRNRTTFNSSQLQALERVFERTHYPDAFVREELARR     71 - 140
VNLSEARVQVWFQNRRAKFRRNERAMLASRSASLLKSYSQEAAIEQPVAPRPTALSPDYLSWTASSPYST    141 - 210
VPPYSPGSSGPATPGVNMANSIASLRLKAKEFSLHHSQVPTVN                               211 - 253
//

Text Mined References (13)

PMID Year Title