Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.71
PubTator Score 5.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.500 6.8e-03
astrocytic glioma -2.700 1.4e-03
Astrocytoma, Pilocytic -2.200 2.1e-06
Atopic dermatitis -1.800 1.0e-04
atypical teratoid / rhabdoid tumor -1.400 1.2e-02
Breast cancer -1.200 4.0e-17
cutaneous lupus erythematosus -1.100 1.7e-03
ductal carcinoma in situ -1.600 6.4e-03
ependymoma -3.100 6.5e-04
glioblastoma -1.300 1.0e-03
group 3 medulloblastoma -1.600 3.4e-02
invasive ductal carcinoma -2.060 1.1e-03
medulloblastoma, large-cell -1.800 1.3e-02
oligodendroglioma -2.600 8.9e-03
Pick disease -1.700 8.0e-04
psoriasis -1.200 6.1e-16

AA Sequence

MAVFLEAKDAHSVLKRFPRANEFLEELRQGTIERECMEEICSYEEVKEVFENKEKTMEFWKGYPNAVYSV      1 - 70
RDPSQSSDAMYVVVPLLGVALLIVIALFIIWRCQLQKATRHHPSYAQNRYLASRAGHTLPRVMVYRGTVH     71 - 140
SQGEPSGHREAANSPQVVLGPSRGGRTTVRLESTLYLPELSLSRLSSTTPPPSYEEVTAPQESSSEEASV    141 - 210
SYSDPPPKYEEIVAANPGADK                                                     211 - 231
//

Text Mined References (6)

PMID Year Title