Property Summary

NCBI Gene PubMed Count 6
PubMed Score 7.36
PubTator Score 0.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung adenocarcinoma 2714 2.0e-13
osteosarcoma 7933 1.1e-04
fibroadenoma 557 1.7e-02

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.407 1.1e-04
fibroadenoma 1.100 1.7e-02
lung adenocarcinoma 1.700 2.0e-13

Gene RIF (1)

PMID Text
21460222 PRR7 is a potential regulator of signaling and apoptosis in activated T cells.

AA Sequence

MVMSQGTYTFLTCFAGFWLIWGLIVLLCCFCSFLRRRLKRRQEERLREQNLRALELEPLELEGSLAGSPP      1 - 70
GLAPPQPPPHRSRLEAPAHAHSHPHVHVHPLLHHGPAQPHAHAHPHPHHHALPHPPPTHLSVPPRPWSYP     71 - 140
RQAESDMSKPPCYEEAVLMAEPPPPYSEVLTDTRGLYRKIVTPFLSRRDSAEKQEQPPPSYKPLFLDRGY    141 - 210
TSALHLPSAPRPAPPCPALCLQADRGRRVFPSWTDSELSSREPLEHGAWRLPVSIPLFGRTTAV          211 - 274
//

Text Mined References (7)

PMID Year Title
22703881 2012 Genetic associations for activated partial thromboplastin time and prothrombin time, their gene expression profiles, and risk of coronary artery disease.
21460222 2011 PRR7 is a transmembrane adaptor protein expressed in activated T cells involved in regulation of T cell receptor signaling and apoptosis.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15629447 2005 Proteomic analysis revealed a novel synaptic proline-rich membrane protein (PRR7) associated with PSD-95 and NMDA receptor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.