Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.97
PubTator Score 1.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 2.800 2.5e-08
psoriasis 1.100 2.5e-03
osteosarcoma -2.036 7.8e-05
colon cancer 1.300 3.1e-03
group 3 medulloblastoma -1.300 1.1e-02
gastric carcinoma 1.100 3.5e-02
ductal carcinoma in situ -1.200 2.5e-03
invasive ductal carcinoma -1.300 2.3e-02
ovarian cancer 1.900 3.1e-06
pituitary cancer -1.700 3.4e-04

Protein-protein Interaction (5)

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17599906 The inhibition of Akt and S6K1 phosphorylation by PRR5 knock down correlates with reduction in the expression level of platelet-derived growth factor receptor beta (PDGFRbeta).
17461779 It was demonstrated that immunoprecipitation of Protor-1 or Protor-2 results in the co-immunoprecipitation of other mTORC2 subunits, but not Raptor, a specific component of mTORC1.
15718101 mRNA expression analyses revealed PRR5 overexpression in a majority of colorectal tumors but substantial downregulation of PRR5 expression in a subset of breast tumors and reduced expression in two breast cancer cell lines

AA Sequence

MRTLRRLKFMSSPSLSDLGKREPAAAADERGTQQRRACANATWNSIHNGVIAVFQRKGLPDQELFSLNEG      1 - 70
VRQLLKTELGSFFTEYLQNQLLTKGMVILRDKIRFYEGQKLLDSLAETWDFFFSDVLPMLQAIFYPVQGK     71 - 140
EPSVRQLALLHFRNAITLSVKLEDALARAHARVPPAIVQMLLVLQGVHESRGVTEDYLRLETLVQKVVSP    141 - 210
YLGTYGLHSSEGPFTHSCILEKRLLRRSRSGDVLAKNPVVRSKSYNTPLLNPVQEHEAEGAAAGGTSIRR    211 - 280
HSVSEMTSCPEPQGFSDPPGQGPTGTFRSSPAPHSGPCPSRLYPTTQPPEQGLDPTRSSLPRSSPENLVD    281 - 350
QILESVDSDSEGIFIDFGRGRGSGMSDLEGSGGRQSVV                                    351 - 388
//

Text Mined References (16)

PMID Year Title
24882193 2014 Bipolar disorder with comorbid binge eating history: a genome-wide association study implicates APOB.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22609986 2012 PRR5L degradation promotes mTORC2-mediated PKC-? phosphorylation and cell migration downstream of G?12.
22554406 2012 Family-based genome-wide association study of frontal ? oscillations identifies potassium channel gene KCNJ6.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17599906 2007 PRR5, a novel component of mTOR complex 2, regulates platelet-derived growth factor receptor beta expression and signaling.
17461779 2007 Identification of Protor as a novel Rictor-binding component of mTOR complex-2.
15718101 2005 PRR5 encodes a conserved proline-rich protein predominant in kidney: analysis of genomic organization, expression, and mutation status in breast and colorectal carcinomas.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12529303 2003 Reevaluating human gene annotation: a second-generation analysis of chromosome 22.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.