Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.19
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 1.8e-04

Synonym

Accession B1ATL7
Symbols CXorf64

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 HCA RNA Cell Line (2)

AA Sequence

MACIENVLGGHAPSPLVVSVDKNGNQELHHDMPLQCLSSKPEDDAEPWGQPQVPLRPSVNVLTDLDSKQL      1 - 70
EWPSERTGSCIPLHSLRAHRHPYGPPPAVAEESLATAEVNSSDALAGWRQEGQDAINVSWEVSGGPPALI     71 - 140
VGGTKVNNGGTERGSNNARLHVALPQGKGFFPPRGPQVRGPSHIPTLRSGIVMEVPPGNTRIACRGKLAH    141 - 210
VSFPLRGPCHPMHNWPRPIPLSSSTPGLPSCSTVHCFIPPRPPIFNPFLTMPLPFAPPPIFGPPLPSYFA    211 - 280
HFHSGGMPAPASPNREHS                                                        281 - 298
//

Text Mined References (3)

PMID Year Title
21375368 2011 Differential gene expression in patients with amyotrophic lateral sclerosis.
15772651 2005 The DNA sequence of the human X chromosome.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.